BDGP Sequence Production Resources |
Search the DGRC for LP16703
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 167 |
Well: | 3 |
Vector: | pOT2 |
Associated Gene/Transcript | CG7587-RA |
Protein status: | LP16703.pep: gold |
Sequenced Size: | 553 |
553 bp assembled on 2010-02-11
GenBank Submission: BT120314.1
> LP16703.complete TGCACGATCAATCGCCTAAAATGTTCAATATTATCCTTCTGGCAACAATC CTAGTGAGCGTGGCTCAGGCCACAATCATCATTAAGCCCGAAAATCCCGT GGAGGAGACCACCAAGTGCCAGATCTACTGGCGCGAACACGCCTGGGCTC TTGAAGATTGTGTGTGCCGGGTCTTCCAGAACGGCTGTCTTCTGAACGAG GAGAGCAATCGGCGGGAAAAGGCTGGAAAAACCCCTCTAATTCCGGTCAC CGAGCAGGTGTGCCAGAAGTTCATCAAGCGCAAGTGCTTCCTTGGATGGC CTGTGCTGGCCAAGTTCCCGATTCCATCGCCATGCGGATGCAATGGCAAA CAGGGCAGTCTGGAAATCAAGAAGTTTTTGAGTCTGTGCGAACTGCAGAA GTACGCAGCTGAATGCAACAAACCCTATATCAGCTACTCGAAGTGTTAAA AGATGACTTGTAATTGATGATGATAATTTGACTACCTCGAACGCGTCCTT GTTAAAAATAATGAATAAACATTTTAAAGCAGCAAAAAAAAAAAAAAAAA AAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7587-RA | 651 | CG7587-RA | 114..649 | 1..536 | 2680 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 13418739..13418972 | 1..234 | 1155 | 99.6 | Plus |
chr3R | 27901430 | chr3R | 13419038..13419226 | 235..423 | 945 | 100 | Plus |
chr3R | 27901430 | chr3R | 13419284..13419393 | 424..533 | 550 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 17594403..17594636 | 1..234 | 1170 | 100 | Plus |
3R | 32079331 | 3R | 17594702..17594890 | 235..423 | 945 | 100 | Plus |
3R | 32079331 | 3R | 17594948..17595060 | 424..536 | 565 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 17335234..17335467 | 1..234 | 1170 | 100 | Plus |
3R | 31820162 | 3R | 17335533..17335721 | 235..423 | 945 | 100 | Plus |
3R | 31820162 | 3R | 17335779..17335891 | 424..536 | 565 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
F-element | 4708 | F-element F 4708bp | 3265..3309 | 415..372 | 105 | 73.3 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 13418739..13418972 | 1..234 | 99 | -> | Plus |
chr3R | 13419038..13419226 | 235..423 | 100 | -> | Plus |
chr3R | 13419284..13419393 | 424..533 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7587-RA | 1..429 | 21..449 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7587-RA | 1..429 | 21..449 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7587-RA | 1..429 | 21..449 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7587-RA | 1..429 | 21..449 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7587-RA | 1..429 | 21..449 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7587-RA | 18..550 | 1..533 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7587-RA | 18..550 | 1..533 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7587-RA | 18..550 | 1..533 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17594702..17594890 | 235..423 | 100 | -> | Plus |
3R | 17594948..17595057 | 424..533 | 100 | Plus | |
3R | 17594403..17594636 | 1..234 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17594702..17594890 | 235..423 | 100 | -> | Plus |
3R | 17594948..17595057 | 424..533 | 100 | Plus | |
3R | 17594403..17594636 | 1..234 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17594702..17594890 | 235..423 | 100 | -> | Plus |
3R | 17594948..17595057 | 424..533 | 100 | Plus | |
3R | 17594403..17594636 | 1..234 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 13420125..13420358 | 1..234 | 100 | -> | Plus |
arm_3R | 13420424..13420612 | 235..423 | 100 | -> | Plus |
arm_3R | 13420670..13420779 | 424..533 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17335234..17335467 | 1..234 | 100 | -> | Plus |
3R | 17335533..17335721 | 235..423 | 100 | -> | Plus |
3R | 17335779..17335888 | 424..533 | 100 | Plus |
Translation from 2 to 448
> LP16703.hyp HDQSPKMFNIILLATILVSVAQATIIIKPENPVEETTKCQIYWREHAWAL EDCVCRVFQNGCLLNEESNRREKAGKTPLIPVTEQVCQKFIKRKCFLGWP VLAKFPIPSPCGCNGKQGSLEIKKFLSLCELQKYAAECNKPYISYSKC*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7587-PA | 142 | CG7587-PA | 1..142 | 7..148 | 772 | 100 | Plus |
Sgs5-PA | 163 | CG7596-PA | 1..160 | 7..148 | 395 | 46.2 | Plus |
CG42823-PA | 151 | CG42823-PA | 38..143 | 38..144 | 145 | 33.6 | Plus |
Translation from 2 to 448
> LP16703.pep HDQSPKMFNIILLATILVSVAQATIIIKPENPVEETTKCQIYWREHAWAL EDCVCRVFQNGCLLNEESNRREKAGKTPLIPVTEQVCQKFIKRKCFLGWP VLAKFPIPSPCGCNGKQGSLEIKKFLSLCELQKYAAECNKPYISYSKC*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16411-PA | 172 | GF16411-PA | 35..162 | 19..146 | 302 | 43.8 | Plus |
Dana\GF19880-PA | 166 | GF19880-PA | 3..134 | 7..136 | 269 | 49.2 | Plus |
Dana\GF18614-PA | 144 | GF18614-PA | 2..136 | 4..144 | 161 | 31 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22329-PA | 142 | GG22329-PA | 1..142 | 7..148 | 627 | 85.2 | Plus |
Dere\GG16775-PA | 145 | GG16775-PA | 2..137 | 5..144 | 158 | 32.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7587-PA | 142 | CG7587-PA | 1..142 | 7..148 | 772 | 100 | Plus |
Sgs5-PA | 163 | CG7596-PA | 1..160 | 7..148 | 395 | 46.2 | Plus |
CG42823-PA | 151 | CG42823-PA | 38..143 | 38..144 | 145 | 33.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24797-PA | 145 | GI24797-PA | 1..143 | 7..148 | 296 | 39.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13780-PA | 144 | GL13780-PA | 1..140 | 7..146 | 431 | 56.4 | Plus |
Dper\GL23939-PA | 148 | GL23939-PA | 35..139 | 36..143 | 154 | 33 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20459-PA | 144 | GA20459-PA | 1..140 | 7..146 | 427 | 55.7 | Plus |
Dpse\GA27116-PA | 148 | GA27116-PA | 35..140 | 36..144 | 154 | 32.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15244-PA | 142 | GM15244-PA | 1..142 | 7..148 | 720 | 95.1 | Plus |
Dsec\GM15245-PA | 169 | GM15245-PA | 54..166 | 36..148 | 375 | 54.9 | Plus |
Dsec\GM15365-PA | 151 | GM15365-PA | 1..143 | 7..144 | 136 | 27.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19169-PA | 142 | GD19169-PA | 1..142 | 7..148 | 721 | 94.4 | Plus |
Dsim\GD19170-PA | 169 | GD19170-PA | 54..166 | 36..148 | 373 | 54.9 | Plus |
Dsim\GD20234-PA | 151 | GD20234-PA | 13..143 | 10..144 | 141 | 31.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24445-PA | 143 | GJ24445-PA | 1..139 | 7..148 | 321 | 45.8 | Plus |
Dvir\GJ22824-PA | 146 | GJ22824-PA | 3..137 | 6..144 | 149 | 30 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25480-PA | 142 | GE25480-PA | 1..142 | 7..148 | 634 | 83.1 | Plus |
Dyak\GE25481-PA | 192 | GE25481-PA | 77..189 | 36..148 | 352 | 52.2 | Plus |
Dyak\GE24167-PA | 148 | GE24167-PA | 10..140 | 10..144 | 142 | 31.2 | Plus |