Clone LP16703 Report

Search the DGRC for LP16703

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:167
Well:3
Vector:pOT2
Associated Gene/TranscriptCG7587-RA
Protein status:LP16703.pep: gold
Sequenced Size:553

Clone Sequence Records

LP16703.complete Sequence

553 bp assembled on 2010-02-11

GenBank Submission: BT120314.1

> LP16703.complete
TGCACGATCAATCGCCTAAAATGTTCAATATTATCCTTCTGGCAACAATC
CTAGTGAGCGTGGCTCAGGCCACAATCATCATTAAGCCCGAAAATCCCGT
GGAGGAGACCACCAAGTGCCAGATCTACTGGCGCGAACACGCCTGGGCTC
TTGAAGATTGTGTGTGCCGGGTCTTCCAGAACGGCTGTCTTCTGAACGAG
GAGAGCAATCGGCGGGAAAAGGCTGGAAAAACCCCTCTAATTCCGGTCAC
CGAGCAGGTGTGCCAGAAGTTCATCAAGCGCAAGTGCTTCCTTGGATGGC
CTGTGCTGGCCAAGTTCCCGATTCCATCGCCATGCGGATGCAATGGCAAA
CAGGGCAGTCTGGAAATCAAGAAGTTTTTGAGTCTGTGCGAACTGCAGAA
GTACGCAGCTGAATGCAACAAACCCTATATCAGCTACTCGAAGTGTTAAA
AGATGACTTGTAATTGATGATGATAATTTGACTACCTCGAACGCGTCCTT
GTTAAAAATAATGAATAAACATTTTAAAGCAGCAAAAAAAAAAAAAAAAA
AAA

LP16703.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG7587-RA 651 CG7587-RA 114..649 1..536 2680 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13418739..13418972 1..234 1155 99.6 Plus
chr3R 27901430 chr3R 13419038..13419226 235..423 945 100 Plus
chr3R 27901430 chr3R 13419284..13419393 424..533 550 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:57:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17594403..17594636 1..234 1170 100 Plus
3R 32079331 3R 17594702..17594890 235..423 945 100 Plus
3R 32079331 3R 17594948..17595060 424..536 565 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17335234..17335467 1..234 1170 100 Plus
3R 31820162 3R 17335533..17335721 235..423 945 100 Plus
3R 31820162 3R 17335779..17335891 424..536 565 100 Plus
Blast to na_te.dros performed 2019-03-16 21:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
F-element 4708 F-element F 4708bp 3265..3309 415..372 105 73.3 Minus

LP16703.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:54:07 Download gff for LP16703.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13418739..13418972 1..234 99 -> Plus
chr3R 13419038..13419226 235..423 100 -> Plus
chr3R 13419284..13419393 424..533 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-11 18:11:47 Download gff for LP16703.complete
Subject Subject Range Query Range Percent Splice Strand
CG7587-RA 1..429 21..449 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:26:33 Download gff for LP16703.complete
Subject Subject Range Query Range Percent Splice Strand
CG7587-RA 1..429 21..449 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:04:54 Download gff for LP16703.complete
Subject Subject Range Query Range Percent Splice Strand
CG7587-RA 1..429 21..449 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:35:24 Download gff for LP16703.complete
Subject Subject Range Query Range Percent Splice Strand
CG7587-RA 1..429 21..449 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-11 18:11:47 Download gff for LP16703.complete
Subject Subject Range Query Range Percent Splice Strand
CG7587-RA 1..429 21..449 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:26:33 Download gff for LP16703.complete
Subject Subject Range Query Range Percent Splice Strand
CG7587-RA 18..550 1..533 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:04:54 Download gff for LP16703.complete
Subject Subject Range Query Range Percent Splice Strand
CG7587-RA 18..550 1..533 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:35:24 Download gff for LP16703.complete
Subject Subject Range Query Range Percent Splice Strand
CG7587-RA 18..550 1..533 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:54:07 Download gff for LP16703.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17594702..17594890 235..423 100 -> Plus
3R 17594948..17595057 424..533 100   Plus
3R 17594403..17594636 1..234 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:54:07 Download gff for LP16703.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17594702..17594890 235..423 100 -> Plus
3R 17594948..17595057 424..533 100   Plus
3R 17594403..17594636 1..234 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:54:07 Download gff for LP16703.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17594702..17594890 235..423 100 -> Plus
3R 17594948..17595057 424..533 100   Plus
3R 17594403..17594636 1..234 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:04:54 Download gff for LP16703.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13420125..13420358 1..234 100 -> Plus
arm_3R 13420424..13420612 235..423 100 -> Plus
arm_3R 13420670..13420779 424..533 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:13:07 Download gff for LP16703.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17335234..17335467 1..234 100 -> Plus
3R 17335533..17335721 235..423 100 -> Plus
3R 17335779..17335888 424..533 100   Plus

LP16703.hyp Sequence

Translation from 2 to 448

> LP16703.hyp
HDQSPKMFNIILLATILVSVAQATIIIKPENPVEETTKCQIYWREHAWAL
EDCVCRVFQNGCLLNEESNRREKAGKTPLIPVTEQVCQKFIKRKCFLGWP
VLAKFPIPSPCGCNGKQGSLEIKKFLSLCELQKYAAECNKPYISYSKC*

LP16703.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:54:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG7587-PA 142 CG7587-PA 1..142 7..148 772 100 Plus
Sgs5-PA 163 CG7596-PA 1..160 7..148 395 46.2 Plus
CG42823-PA 151 CG42823-PA 38..143 38..144 145 33.6 Plus

LP16703.pep Sequence

Translation from 2 to 448

> LP16703.pep
HDQSPKMFNIILLATILVSVAQATIIIKPENPVEETTKCQIYWREHAWAL
EDCVCRVFQNGCLLNEESNRREKAGKTPLIPVTEQVCQKFIKRKCFLGWP
VLAKFPIPSPCGCNGKQGSLEIKKFLSLCELQKYAAECNKPYISYSKC*

LP16703.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16411-PA 172 GF16411-PA 35..162 19..146 302 43.8 Plus
Dana\GF19880-PA 166 GF19880-PA 3..134 7..136 269 49.2 Plus
Dana\GF18614-PA 144 GF18614-PA 2..136 4..144 161 31 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22329-PA 142 GG22329-PA 1..142 7..148 627 85.2 Plus
Dere\GG16775-PA 145 GG16775-PA 2..137 5..144 158 32.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG7587-PA 142 CG7587-PA 1..142 7..148 772 100 Plus
Sgs5-PA 163 CG7596-PA 1..160 7..148 395 46.2 Plus
CG42823-PA 151 CG42823-PA 38..143 38..144 145 33.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24797-PA 145 GI24797-PA 1..143 7..148 296 39.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13780-PA 144 GL13780-PA 1..140 7..146 431 56.4 Plus
Dper\GL23939-PA 148 GL23939-PA 35..139 36..143 154 33 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20459-PA 144 GA20459-PA 1..140 7..146 427 55.7 Plus
Dpse\GA27116-PA 148 GA27116-PA 35..140 36..144 154 32.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15244-PA 142 GM15244-PA 1..142 7..148 720 95.1 Plus
Dsec\GM15245-PA 169 GM15245-PA 54..166 36..148 375 54.9 Plus
Dsec\GM15365-PA 151 GM15365-PA 1..143 7..144 136 27.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19169-PA 142 GD19169-PA 1..142 7..148 721 94.4 Plus
Dsim\GD19170-PA 169 GD19170-PA 54..166 36..148 373 54.9 Plus
Dsim\GD20234-PA 151 GD20234-PA 13..143 10..144 141 31.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24445-PA 143 GJ24445-PA 1..139 7..148 321 45.8 Plus
Dvir\GJ22824-PA 146 GJ22824-PA 3..137 6..144 149 30 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25480-PA 142 GE25480-PA 1..142 7..148 634 83.1 Plus
Dyak\GE25481-PA 192 GE25481-PA 77..189 36..148 352 52.2 Plus
Dyak\GE24167-PA 148 GE24167-PA 10..140 10..144 142 31.2 Plus