Clone LP17418 Report

Search the DGRC for LP17418

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:174
Well:18
Vector:pOT2
Associated Gene/TranscriptCG9065-RA
Protein status:LP17418.pep: gold
Sequenced Size:502

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9065-RA 2009-01-21 est gleaning
CG9065 2009-06-08 Manual selection by Joe Carlson

Clone Sequence Records

LP17418.complete Sequence

502 bp assembled on 2009-10-06

GenBank Submission: BT099957.1

> LP17418.complete
CCGATAAACCGAATTGTGGTGAAATATCCGTCTCGAACCGCTTTTGACCG
ATACCCGATTGAAGAATGGGCAACAGTGCATCTCAAGGAGTTGCAGCTCC
AAGTGTTTCGGCGGCCCACCCGTTGACCACCGCATCCGCAGCCACCGCAT
CCACAACCACCGCATCCGCAGCCACCGCATCCGGCGAGAAGCCCAAGTGC
AAGGCCTGTTGCGCCTGCCCGGAGACCAAGAGGGCACGTGACGCCTGCAT
TGTGGAGAACGGCGAGGAGAATTGCTTGGCGCTGATAGAGGCGCACAAGA
AGTGCATGCGCGATGCCGGCTTCAATATCTAGATATACCGACACATCCTG
GGATGAGGACACCAGGATTATAGGATAACACTAGTCCTGCACACACTCCC
CCCAGTGCCACTCCTCGGATCCCCAGCCCCTTCAACTGTTTGTTTTTGTT
GCATCTCAAGCTAATTATAGAACTAAATTAATTGAAAAAAAAAAAAAAAA
AA

LP17418.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:19:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG9065-RA 761 CG9065-RA 156..643 1..488 2440 100 Plus
CG9065.a 610 CG9065.a 150..600 38..488 2255 100 Plus
CG9065.a 610 CG9065.a 50..86 1..37 185 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:02:49
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 14974195..14974432 484..247 1190 100 Minus
chrX 22417052 chrX 14974519..14974728 247..38 1050 100 Minus
chrX 22417052 chrX 14974792..14974828 37..1 185 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:57:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15084025..15084266 488..247 1210 100 Minus
X 23542271 X 15084353..15084562 247..38 1050 100 Minus
X 23542271 X 15084626..15084662 37..1 185 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15092123..15092364 488..247 1210 100 Minus
X 23527363 X 15092451..15092660 247..38 1050 100 Minus
X 23527363 X 15092724..15092760 37..1 185 100 Minus
Blast to na_te.dros performed on 2019-03-16 17:02:48 has no hits.

LP17418.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:03:28 Download gff for LP17418.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 14974195..14974431 248..484 100 <- Minus
chrX 14974519..14974728 38..247 100 <- Minus
chrX 14974792..14974828 1..37 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:47 Download gff for LP17418.complete
Subject Subject Range Query Range Percent Splice Strand
CG9065-RA 1..267 66..332 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:29:16 Download gff for LP17418.complete
Subject Subject Range Query Range Percent Splice Strand
CG9065-RA 1..267 66..332 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:27:52 Download gff for LP17418.complete
Subject Subject Range Query Range Percent Splice Strand
CG9065-RA 1..267 66..332 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:49:58 Download gff for LP17418.complete
Subject Subject Range Query Range Percent Splice Strand
CG9065-RA 1..267 66..332 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-06 11:22:31 Download gff for LP17418.complete
Subject Subject Range Query Range Percent Splice Strand
CG9065-RA 1..477 8..484 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:29:16 Download gff for LP17418.complete
Subject Subject Range Query Range Percent Splice Strand
CG9065-RA 1..477 8..484 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:52 Download gff for LP17418.complete
Subject Subject Range Query Range Percent Splice Strand
CG9065-RA 38..521 1..484 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:49:58 Download gff for LP17418.complete
Subject Subject Range Query Range Percent Splice Strand
CG9065-RA 38..521 1..484 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:03:28 Download gff for LP17418.complete
Subject Subject Range Query Range Percent Splice Strand
X 15084029..15084265 248..484 100 <- Minus
X 15084353..15084562 38..247 100 <- Minus
X 15084626..15084662 1..37 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:03:28 Download gff for LP17418.complete
Subject Subject Range Query Range Percent Splice Strand
X 15084029..15084265 248..484 100 <- Minus
X 15084353..15084562 38..247 100 <- Minus
X 15084626..15084662 1..37 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:03:28 Download gff for LP17418.complete
Subject Subject Range Query Range Percent Splice Strand
X 15084029..15084265 248..484 100 <- Minus
X 15084353..15084562 38..247 100 <- Minus
X 15084626..15084662 1..37 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:52 Download gff for LP17418.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14978659..14978695 1..37 100   Minus
arm_X 14978062..14978298 248..484 100 <- Minus
arm_X 14978386..14978595 38..247 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:02:07 Download gff for LP17418.complete
Subject Subject Range Query Range Percent Splice Strand
X 15092724..15092760 1..37 100   Minus
X 15092127..15092363 248..484 100 <- Minus
X 15092451..15092660 38..247 100 <- Minus

LP17418.hyp Sequence

Translation from 65 to 331

> LP17418.hyp
MGNSASQGVAAPSVSAAHPLTTASAATASTTTASAATASGEKPKCKACCA
CPETKRARDACIVENGEENCLALIEAHKKCMRDAGFNI*

LP17418.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG9065-PA 88 CG9065-PA 1..88 1..88 457 100 Plus

LP17418.pep Sequence

Translation from 65 to 331

> LP17418.pep
MGNSASQGVAAPSVSAAHPLTTASAATASTTTASAATASGEKPKCKACCA
CPETKRARDACIVENGEENCLALIEAHKKCMRDAGFNI*

LP17418.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21058-PA 86 GF21058-PA 39..86 41..88 251 97.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19421-PA 78 GG19421-PA 1..78 1..88 354 83 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24313-PA 77 GH24313-PA 1..77 1..88 244 60.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG9065-PA 88 CG9065-PA 1..88 1..88 457 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:25:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21558-PA 78 GI21558-PA 1..78 1..88 244 64.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15207-PA 76 GL15207-PA 1..76 1..88 264 61.4 Plus
Dper\GL15625-PA 75 GL15625-PA 1..75 1..88 241 55.7 Plus
Dper\GL25652-PA 98 GL25652-PA 1..98 1..88 210 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22906-PA 76 GA22906-PA 1..76 1..88 245 61.4 Plus
Dpse\GA29150-PA 75 GA29150-PA 1..75 1..88 235 54.5 Plus
Dpse\GA23194-PA 75 GA23194-PA 1..75 1..88 235 54.5 Plus
Dpse\GA25371-PA 98 GA25371-PA 1..98 1..88 213 52 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12008-PA 78 GM12008-PA 1..78 1..88 380 88.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15822-PA 78 GD15822-PA 1..78 1..88 373 87.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15703-PA 78 GJ15703-PA 1..78 1..88 268 61.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16345-PA 80 GK16345-PA 1..80 1..88 262 64.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16072-PA 78 GE16072-PA 1..78 1..88 356 83 Plus