Clone LP18243 Report

Search the DGRC for LP18243

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:182
Well:43
Vector:pOT2
Associated Gene/TranscriptCG14300-RA
Protein status:LP18243.pep: gold
Sequenced Size:359

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14300 2008-04-29 Release 5.5 accounting
CG14300 2008-08-15 Release 5.9 accounting
CG14300 2008-12-18 5.12 accounting

Clone Sequence Records

LP18243.complete Sequence

359 bp assembled on 2007-12-07

GenBank Submission: BT031337

> LP18243.complete
CTTCTATCGAGAAACTTTCACAGCTAAAAATGAAGTCTGTTGTTGCCCTG
TTTGCCACCGTTTTGGCCATTATTTTGGTGGCTGGAGTGAGTGCGGATGC
GGGTCGCTCCGCCTGCAAGGATGAGTCCGAGATTGGACAGACCTATACGC
ATCACTTCGATGCCGCTAAGTACTGGCTGTGCGAGACCCTTGGCGTTCCG
GCCACCGAGGTGGACTGCCCCGCGGGACTGGCCTACATGCATCTGCTCAA
GGAGTGCATCCCATGGGCCAGTTACATCTGGAAGAAGCCCGAGATGCCAC
CAACTGTGGCCTGAAAATAAATGACCCAGCTCTTGAACGTTAAAAAAAAA
AAAAAAAAA

LP18243.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG14300-RA 432 CG14300-RA 31..371 1..341 1705 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14517414..14517716 341..39 1470 99 Minus
chr3R 27901430 chr3R 14517778..14517816 39..1 195 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:57:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:07:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18693293..18693595 341..39 1515 100 Minus
3R 32079331 3R 18693657..18693695 39..1 195 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18434124..18434426 341..39 1515 100 Minus
3R 31820162 3R 18434488..18434526 39..1 195 100 Minus
Blast to na_te.dros performed on 2019-03-16 22:07:34 has no hits.

LP18243.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:08:37 Download gff for LP18243.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14517414..14517715 40..341 99 <- Minus
chr3R 14517778..14517816 1..39 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:43:27 Download gff for LP18243.complete
Subject Subject Range Query Range Percent Splice Strand
CG14300-RA 1..285 30..314 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:05:50 Download gff for LP18243.complete
Subject Subject Range Query Range Percent Splice Strand
CG14300-RA 1..285 30..314 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:08:52 Download gff for LP18243.complete
Subject Subject Range Query Range Percent Splice Strand
CG14300-RA 1..285 30..314 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:52:08 Download gff for LP18243.complete
Subject Subject Range Query Range Percent Splice Strand
CG14300-RA 1..285 30..314 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:33:56 Download gff for LP18243.complete
Subject Subject Range Query Range Percent Splice Strand
CG14300-RA 1..285 30..314 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:00:21 Download gff for LP18243.complete
Subject Subject Range Query Range Percent Splice Strand
CG14300-RA 1..341 1..341 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:05:50 Download gff for LP18243.complete
Subject Subject Range Query Range Percent Splice Strand
CG14300-RA 1..341 1..341 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:08:52 Download gff for LP18243.complete
Subject Subject Range Query Range Percent Splice Strand
CG14300-RA 12..352 1..341 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:52:08 Download gff for LP18243.complete
Subject Subject Range Query Range Percent Splice Strand
CG14300-RA 1..341 1..341 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:33:56 Download gff for LP18243.complete
Subject Subject Range Query Range Percent Splice Strand
CG14300-RA 17..357 1..341 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:08:37 Download gff for LP18243.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18693293..18693594 40..341 100 <- Minus
3R 18693657..18693695 1..39 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:08:37 Download gff for LP18243.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18693293..18693594 40..341 100 <- Minus
3R 18693657..18693695 1..39 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:08:37 Download gff for LP18243.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18693293..18693594 40..341 100 <- Minus
3R 18693657..18693695 1..39 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:08:52 Download gff for LP18243.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14519015..14519316 40..341 100 <- Minus
arm_3R 14519379..14519417 1..39 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:58:03 Download gff for LP18243.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18434124..18434425 40..341 100 <- Minus
3R 18434488..18434526 1..39 100   Minus

LP18243.hyp Sequence

Translation from 2 to 313

> LP18243.hyp
SIEKLSQLKMKSVVALFATVLAIILVAGVSADAGRSACKDESEIGQTYTH
HFDAAKYWLCETLGVPATEVDCPAGLAYMHLLKECIPWASYIWKKPEMPP
TVA*

LP18243.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG14300-PA 94 CG14300-PA 1..94 10..103 504 100 Plus
CG14645-PA 97 CG14645-PA 1..91 10..99 161 34.1 Plus
CG14245-PB 103 CG14245-PB 22..97 27..101 156 34.2 Plus
CG14245-PA 103 CG14245-PA 22..97 27..101 156 34.2 Plus

LP18243.pep Sequence

Translation from 29 to 313

> LP18243.pep
MKSVVALFATVLAIILVAGVSADAGRSACKDESEIGQTYTHHFDAAKYWL
CETLGVPATEVDCPAGLAYMHLLKECIPWASYIWKKPEMPPTVA*

LP18243.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:08:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17869-PA 94 GF17869-PA 1..93 1..93 425 83.9 Plus
Dana\GF16453-PA 104 GF16453-PA 3..97 8..92 170 34.7 Plus
Dana\GF18205-PA 97 GF18205-PA 1..91 1..90 159 34.1 Plus
Dana\GF16020-PA 95 GF16020-PA 1..89 1..90 148 35.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:08:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16351-PA 94 GG16351-PA 1..94 1..94 478 95.7 Plus
Dere\GG12307-PA 99 GG12307-PA 1..91 1..90 147 33 Plus
Dere\GG11498-PA 103 GG11498-PA 22..97 18..92 136 31.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:08:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22109-PA 92 GH22109-PA 14..91 16..93 376 88.5 Plus
Dgri\GH18866-PA 98 GH18866-PA 1..93 1..92 176 33.3 Plus
Dgri\GH14236-PA 107 GH14236-PA 5..98 1..92 133 30.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG14300-PA 94 CG14300-PA 1..94 1..94 504 100 Plus
CG14645-PA 97 CG14645-PA 1..91 1..90 161 34.1 Plus
CG14245-PB 103 CG14245-PB 22..97 18..92 156 34.2 Plus
CG14245-PA 103 CG14245-PA 22..97 18..92 156 34.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:08:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21959-PA 92 GI21959-PA 19..92 21..94 362 89.2 Plus
Dmoj\GI24723-PA 97 GI24723-PA 1..91 1..90 150 30.8 Plus
Dmoj\GI22144-PA 99 GI22144-PA 6..95 7..92 132 31.1 Plus
Dmoj\GI22143-PA 104 GI22143-PA 7..95 4..92 128 30.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:08:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23111-PA 95 GL23111-PA 18..95 17..94 404 92.3 Plus
Dper\GL12319-PA 97 GL12319-PA 1..91 1..90 154 30.8 Plus
Dper\GL27219-PA 104 GL27219-PA 8..98 10..92 137 30.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:08:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27144-PA 95 GA27144-PA 1..95 1..94 432 86.3 Plus
Dpse\GA13143-PA 97 GA13143-PA 1..91 1..90 154 30.8 Plus
Dpse\GA26776-PA 104 GA26776-PA 8..98 10..92 138 30.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:08:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18688-PA 94 GM18688-PA 1..94 1..94 492 100 Plus
Dsec\GM10746-PA 97 GM10746-PA 1..95 1..94 157 33.7 Plus
Dsec\GM10341-PA 103 GM10341-PA 3..97 8..92 141 29.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:08:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20155-PA 94 GD20155-PA 1..94 1..94 492 100 Plus
Dsim\GD19718-PA 97 GD19718-PA 1..91 1..90 159 37 Plus
Dsim\GD21301-PA 103 GD21301-PA 3..97 8..92 141 29.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:08:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14319-PA 92 GJ14319-PA 23..92 25..94 354 92.9 Plus
Dvir\GJ14550-PA 97 GJ14550-PA 12..93 11..92 158 38.6 Plus
Dvir\GJ24263-PA 102 GJ24263-PA 6..95 7..92 133 32.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:08:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13552-PA 92 GK13552-PA 1..92 1..94 383 77.7 Plus
Dwil\GK13541-PA 106 GK13541-PA 25..99 19..92 170 44 Plus
Dwil\GK11657-PA 99 GK11657-PA 1..92 1..90 146 34.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:08:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25180-PA 94 GE25180-PA 1..94 1..94 468 93.6 Plus
Dyak\GE25179-PA 94 GE25179-PA 1..94 1..94 468 93.6 Plus
Dyak\GE25408-PA 97 GE25408-PA 1..91 1..90 159 35.2 Plus
Dyak\GE23689-PA 103 GE23689-PA 3..97 8..92 146 30.5 Plus