Clone LP18486 Report

Search the DGRC for LP18486

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:184
Well:86
Vector:pOT2
Associated Gene/TranscriptCp7Fa-RA
Protein status:LP18486.pep: gold
Sequenced Size:1051

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15349 2005-01-26 Blastp of sequenced clone
Cp7Fa 2008-04-29 Release 5.5 accounting
Cp7Fa 2008-08-15 Release 5.9 accounting
Cp7Fa 2008-12-18 5.12 accounting

Clone Sequence Records

LP18486.complete Sequence

1051 bp (1051 high quality bases) assembled on 2005-01-26

GenBank Submission: BT021351

> LP18486.complete
GAACACAGTGATCCGATAAGAACCTTTACAACATGCTAGCCTGCAAGCTT
CTTCTCGCGTTGGTCATGGGAATGCACTGCATTCAATTGTTGATGGCGGC
CTGCGTGTGCTCCGAAAAGGGAACGGACTACTGCCAAAGCTGTCAGGGAT
CCACGGTCATCCGGCCGAAGCCCCGATACTACGAGCCCAGTGACGTTAAC
CTGCCGCCGATCGGAGACAACTGCTGGTGCAGCAAGCAGCTGATCGAACC
CGCCCAACTGCCCAAGACCTGCGGAAAAACCACGCCATGCAAGCCCACCT
GTTCGTGCCAGCAGATCAGCTCCGACAGCAGCTACGCCTCCTCTTCCAGC
TCAGGATCCGTGTACGGAAAAATCGACTATGCCGCAGAGAAGATAGTGGA
CAACAGTCCAGCTGCGGATCCCATCAGCGTGAGTCTGGCCGCCCAGGCTG
GAAAGGCCATCAATGTGCCGGAGGCCAAGTTGGCCTACGGATTTGCCCAG
AAGCCCGTCGATGGTGAGAAAAAGGTGGTGTTCTCCAACGTGCCCGAGGA
GAATCTCTTCAAGCTGAAGAGCGACGTGATCACGCTGAAGAAGCGCACCT
ATGCGACCAAGCAGGAGGATGAGGAGGAGTACGCCGAGGAGGAGCAGGAG
CAGGAACAGTCCTCCGATGATGAGGAGGCACCGCAACTCACCTACAAACA
GCTGGGCTACATCACCGAGCAATACAAGAACCCCAAGTTCAGGAAGATCA
GCAGTTCCAGCTCCAGTTATGCGTACAAGGACTACAAGGATTCCAGCGAG
AGCGGCTACGGTAAAGTGGCCGGCAAGGTGTCCGTGGACTGTGGCTTCAA
GCCCGGCCGGATCACCTCGTACCGGAAGTCAAAACGAGAGGAGTCCGACG
ACGGTTACTACTGAATCAAACCCATCCCCCCATCCAATCCAATTCCAATC
CTTACGTTTGTAAATATGTATATACGCCAAGGAGAGAATGGATGTTTGTC
TAAGTTAGTCTTAAAAAATATACATACGTTTTTAAAAAAAAAAAAAAAAA
A

LP18486.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
Cp7Fa-RA 1264 Cp7Fa-RA 127..1167 1..1041 5205 100 Plus
Cp7Fa-RC 1111 Cp7Fa-RC 448..1111 370..1033 3320 100 Plus
Cp7Fa-RC 1111 Cp7Fa-RC 1..278 1..278 1390 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8364202..8364855 371..1033 3085 98 Plus
chrX 22417052 chrX 8363158..8363347 89..278 950 100 Plus
chrX 22417052 chrX 8364041..8364132 279..370 460 100 Plus
chrX 22417052 chrX 8362664..8362752 1..89 445 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:57:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:16:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8472425..8473095 371..1041 3355 100 Plus
X 23542271 X 8471382..8471571 89..278 950 100 Plus
X 23542271 X 8472264..8472355 279..370 460 100 Plus
X 23542271 X 8470888..8470976 1..89 445 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8480523..8481193 371..1041 3355 100 Plus
X 23527363 X 8479480..8479669 89..278 950 100 Plus
X 23527363 X 8480362..8480453 279..370 460 100 Plus
X 23527363 X 8478986..8479074 1..89 445 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:16:18 has no hits.

LP18486.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:17:24 Download gff for LP18486.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8362664..8362752 1..89 100 -> Plus
chrX 8363159..8363347 90..278 100 -> Plus
chrX 8364041..8364132 279..370 100 -> Plus
chrX 8364202..8364855 371..1033 91   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:43:29 Download gff for LP18486.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fa-RA 1..882 33..914 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:24 Download gff for LP18486.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fa-RA 1..882 33..914 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:58:18 Download gff for LP18486.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fa-RA 1..882 33..914 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:27:25 Download gff for LP18486.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fa-RA 1..882 33..914 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:31:48 Download gff for LP18486.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fa-RA 1..882 33..914 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:55:27 Download gff for LP18486.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fa-RA 1..1033 1..1033 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:24 Download gff for LP18486.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fa-RA 1..1033 1..1033 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:58:18 Download gff for LP18486.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fa-RA 1..1033 1..1033 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:27:25 Download gff for LP18486.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fa-RA 1..1033 1..1033 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:31:48 Download gff for LP18486.complete
Subject Subject Range Query Range Percent Splice Strand
Cp7Fa-RA 1..1033 1..1033 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:17:24 Download gff for LP18486.complete
Subject Subject Range Query Range Percent Splice Strand
X 8470888..8470976 1..89 100 -> Plus
X 8471383..8471571 90..278 100 -> Plus
X 8472264..8472355 279..370 100 -> Plus
X 8472425..8473087 371..1033 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:17:24 Download gff for LP18486.complete
Subject Subject Range Query Range Percent Splice Strand
X 8470888..8470976 1..89 100 -> Plus
X 8471383..8471571 90..278 100 -> Plus
X 8472264..8472355 279..370 100 -> Plus
X 8472425..8473087 371..1033 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:17:24 Download gff for LP18486.complete
Subject Subject Range Query Range Percent Splice Strand
X 8470888..8470976 1..89 100 -> Plus
X 8471383..8471571 90..278 100 -> Plus
X 8472264..8472355 279..370 100 -> Plus
X 8472425..8473087 371..1033 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:58:18 Download gff for LP18486.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8365416..8365604 90..278 100 -> Plus
arm_X 8364921..8365009 1..89 100 -> Plus
arm_X 8366297..8366388 279..370 100 -> Plus
arm_X 8366458..8367120 371..1033 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:00:27 Download gff for LP18486.complete
Subject Subject Range Query Range Percent Splice Strand
X 8480523..8481185 371..1033 100   Plus
X 8478986..8479074 1..89 100 -> Plus
X 8479481..8479669 90..278 100 -> Plus
X 8480362..8480453 279..370 100 -> Plus

LP18486.pep Sequence

Translation from 32 to 913

> LP18486.pep
MLACKLLLALVMGMHCIQLLMAACVCSEKGTDYCQSCQGSTVIRPKPRYY
EPSDVNLPPIGDNCWCSKQLIEPAQLPKTCGKTTPCKPTCSCQQISSDSS
YASSSSSGSVYGKIDYAAEKIVDNSPAADPISVSLAAQAGKAINVPEAKL
AYGFAQKPVDGEKKVVFSNVPEENLFKLKSDVITLKKRTYATKQEDEEEY
AEEEQEQEQSSDDEEAPQLTYKQLGYITEQYKNPKFRKISSSSSSYAYKD
YKDSSESGYGKVAGKVSVDCGFKPGRITSYRKSKREESDDGYY*

LP18486.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22367-PA 290 GF22367-PA 4..290 3..293 1056 79.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18252-PA 292 GG18252-PA 1..292 1..293 1221 95.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12237-PA 284 GH12237-PA 1..283 1..293 897 70.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:26
Subject Length Description Subject Range Query Range Score Percent Strand
Cp7Fa-PA 293 CG33962-PA 1..293 1..293 1540 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15771-PA 293 GI15771-PA 1..292 1..293 861 68.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20313-PA 302 GL20313-PA 1..299 1..291 1011 73.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28808-PA 302 GA28808-PA 1..299 1..291 1011 73.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21594-PA 293 GM21594-PA 1..293 1..293 1505 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16900-PA 308 GD16900-PA 1..283 1..283 1472 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18627-PA 286 GJ18627-PA 1..286 1..293 953 73.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19988-PA 272 GK19988-PA 1..269 14..291 934 73.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15783-PA 303 GE15783-PA 1..303 1..293 1450 93.4 Plus

LP18486.hyp Sequence

Translation from 32 to 913

> LP18486.hyp
MLACKLLLALVMGMHCIQLLMAACVCSEKGTDYCQSCQGSTVIRPKPRYY
EPSDVNLPPIGDNCWCSKQLIEPAQLPKTCGKTTPCKPTCSCQQISSDSS
YASSSSSGSVYGKIDYAAEKIVDNSPAADPISVSLAAQAGKAINVPEAKL
AYGFAQKPVDGEKKVVFSNVPEENLFKLKSDVITLKKRTYATKQEDEEEY
AEEEQEQEQSSDDEEAPQLTYKQLGYITEQYKNPKFRKISSSSSSYAYKD
YKDSSESGYGKVAGKVSVDCGFKPGRITSYRKSKREESDDGYY*

LP18486.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Cp7Fa-PA 293 CG33962-PA 1..293 1..293 1540 100 Plus