Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
LP19328.complete Sequence
1081 bp (1081 high quality bases) assembled on 2004-12-02
GenBank Submission: BT021347
> LP19328.complete
TCTTTTAAAGTACGTCCTGTTACGTCCGAAAAAAATTTAATATAATTTTG
TTTTGGGAAATTAAGGTGCATAAAAAGAAATAAAACGATAAAAGCCTACT
ACCAACTTGTAAAACAATTGTTACGCATGTCATCGCACGGCCTTGCTTAC
ACAACAAGAATTGAAAGAAAGTCTTATAGAGAACTACAAATCAATAGAGA
TCAATACTTTGTAACTGCGCCAAATGAAGAAGATTTGGTTATGAGTTTAT
CTCCAAAGGACACACTTATACATACTGCCATTTCCCAGCACCATCAAGTG
GATACTTCTACTAAATTAAATACAAACGAAACATCGACACAAAATACCGT
ATCTACAGCAGCCGCGGCAGCGGTTGCACATCACCACCACAACCTTTCTA
GTATTCACCACCTCCAAAACCTGCATAGTCAGCATCAAAGTACTTTATTT
AATAGTAATCACTCAACACCCTTTAGCGTGACCGATATCTTAAGTCCAAT
TGAAGAATCGTATCGCAAACTGGAACTGAACGGAAATCCACCATCTCCGT
TTCGATCAAACTCTAGTAGCAGCAGTATTAATTCTCCTGGAACATTAACT
ACATCAACTATGGCGAATCCGTACGCTATGGGAACCTTATATCACAGCCC
AGGTGTACAGACCTATTGCGGACCTACCGATAACCTATCTCTGGCTGGTC
ACTACACTGACATGAGAAATTCTGCATCGTGGTACGGATCAACAGCTAAC
GACCCAAGATTTGCAATTTCACGCCTAATGAGTTCATCAGCCAGTGGAAC
AATGAGTCATATGGGAAACATGAGTGGACTAGCAGCTTGCAGTGTAAGCG
ATTCAAAACCGCTACAGTTTCCTTTAGCACAAAGAAGAAAGCGAAGAGTT
TTGTTTACGCAAGCCCAGGTTGGTACTTACATCCTTAGTTTGCTACTTAA
AAAAAAAACACAAATATTTACCGAATGGAAAGAAGTCAACTTGCTACAGG
CAAAATAAAGGAAAACGTTTGCCTCGACCTGGGGAATATGTTTTAATCGG
GGAATATATTTTAAAAAAAAAAAAAAAAAAA
LP19328.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:52:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
scro-RB | 1260 | scro-RB | 196..1260 | 1..1065 | 5325 | 100 | Plus |
scro-RC | 1911 | scro-RC | 217..1136 | 1..920 | 4600 | 100 | Plus |
scro.a | 2241 | scro.a | 293..1212 | 1..920 | 4600 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:36:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3LHet | 2555433 | chr3LHet | 209153..209621 | 86..554 | 2345 | 100 | Plus |
chr3LHet | 2555433 | chr3LHet | 217364..217659 | 767..1062 | 1480 | 100 | Plus |
chr3LHet | 2555433 | chr3LHet | 211624..211836 | 554..766 | 1065 | 100 | Plus |
chr3LHet | 2555433 | chr3LHet | 207675..207759 | 1..85 | 425 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:58:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:36:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 24725824..24726292 | 86..554 | 2345 | 100 | Plus |
3L | 28110227 | 3L | 24734036..24734334 | 767..1065 | 1495 | 100 | Plus |
3L | 28110227 | 3L | 24728296..24728508 | 554..766 | 1065 | 100 | Plus |
3L | 28110227 | 3L | 24724346..24724430 | 1..85 | 425 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:41:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 24718924..24719392 | 86..554 | 2345 | 100 | Plus |
3L | 28103327 | 3L | 24727136..24727434 | 767..1065 | 1495 | 100 | Plus |
3L | 28103327 | 3L | 24721396..24721608 | 554..766 | 1065 | 100 | Plus |
3L | 28103327 | 3L | 24717446..24717530 | 1..85 | 425 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 18:36:30 has no hits.
LP19328.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:37:14 Download gff for
LP19328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3LHet | 207675..207759 | 1..85 | 100 | -> | Plus |
chr3LHet | 209153..209621 | 86..554 | 100 | -> | Plus |
chr3LHet | 211625..211836 | 555..766 | 100 | -> | Plus |
chr3LHet | 217364..217659 | 767..1062 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:43:38 Download gff for
LP19328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
scro-RB | 1..882 | 127..1008 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:24:11 Download gff for
LP19328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
scro-RB | 1..882 | 127..1008 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:14:43 Download gff for
LP19328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
scro-RB | 1..882 | 127..1008 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:08:25 Download gff for
LP19328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
scro-RB | 1..882 | 127..1008 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:43:51 Download gff for
LP19328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
scro-RB | 1..882 | 127..1008 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:26:07 Download gff for
LP19328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
scro-RB | 1..1062 | 1..1062 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:24:11 Download gff for
LP19328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
scro-RB | 1..1062 | 1..1062 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:14:43 Download gff for
LP19328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
scro-RB | 185..1246 | 1..1062 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:08:25 Download gff for
LP19328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
scro-RB | 1..1062 | 1..1062 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:43:51 Download gff for
LP19328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
scro-RB | 185..1246 | 1..1062 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:37:14 Download gff for
LP19328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 24724346..24724430 | 1..85 | 100 | -> | Plus |
3L | 24725824..24726292 | 86..554 | 100 | -> | Plus |
3L | 24728297..24728508 | 555..766 | 100 | -> | Plus |
3L | 24734036..24734331 | 767..1062 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:37:14 Download gff for
LP19328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 24724346..24724430 | 1..85 | 100 | -> | Plus |
3L | 24725824..24726292 | 86..554 | 100 | -> | Plus |
3L | 24728297..24728508 | 555..766 | 100 | -> | Plus |
3L | 24734036..24734331 | 767..1062 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:37:14 Download gff for
LP19328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 24724346..24724430 | 1..85 | 100 | -> | Plus |
3L | 24725824..24726292 | 86..554 | 100 | -> | Plus |
3L | 24728297..24728508 | 555..766 | 100 | -> | Plus |
3L | 24734036..24734331 | 767..1062 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:14:43 Download gff for
LP19328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3LHet | 207678..207762 | 1..85 | 100 | -> | Plus |
3LHet | 209156..209624 | 86..554 | 100 | -> | Plus |
3LHet | 211629..211840 | 555..766 | 100 | -> | Plus |
3LHet | 217368..217663 | 767..1062 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:44:37 Download gff for
LP19328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 24718924..24719392 | 86..554 | 100 | -> | Plus |
3L | 24721397..24721608 | 555..766 | 100 | -> | Plus |
3L | 24727136..24727431 | 767..1062 | 100 | | Plus |
3L | 24717446..24717530 | 1..85 | 100 | -> | Plus |
LP19328.pep Sequence
Translation from 126 to 1007
> LP19328.pep
MSSHGLAYTTRIERKSYRELQINRDQYFVTAPNEEDLVMSLSPKDTLIHT
AISQHHQVDTSTKLNTNETSTQNTVSTAAAAAVAHHHHNLSSIHHLQNLH
SQHQSTLFNSNHSTPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSSSS
INSPGTLTTSTMANPYAMGTLYHSPGVQTYCGPTDNLSLAGHYTDMRNSA
SWYGSTANDPRFAISRLMSSSASGTMSHMGNMSGLAACSVSDSKPLQFPL
AQRRKRRVLFTQAQVGTYILSLLLKKKTQIFTEWKEVNLLQAK*
LP19328.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:06:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF20558-PA | 429 | GF20558-PA | 1..245 | 39..286 | 910 | 80.6 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:06:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG16309-PA | 430 | GG16309-PA | 1..246 | 39..286 | 1164 | 90.3 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:06:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH18027-PA | 467 | GH18027-PA | 1..281 | 1..286 | 973 | 74.5 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
scro-PB | 293 | CG17594-PB | 1..293 | 1..293 | 1515 | 100 | Plus |
scro-PC | 439 | CG17594-PC | 1..265 | 1..265 | 1375 | 100 | Plus |
scro-PA | 468 | CG17594-PA | 1..265 | 1..265 | 1375 | 100 | Plus |
scro-PF | 307 | CG17594-PF | 1..104 | 162..265 | 546 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:06:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI23787-PA | 466 | GI23787-PA | 12..280 | 13..286 | 945 | 73.7 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:06:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL12355-PA | 467 | GL12355-PA | 1..283 | 1..286 | 1042 | 76.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:06:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM19280-PA | 410 | GM19280-PA | 1..221 | 1..221 | 1144 | 97.7 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:06:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ23616-PA | 467 | GJ23616-PA | 1..281 | 1..286 | 904 | 72.4 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:06:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK10842-PA | 475 | GK10842-PA | 36..291 | 28..286 | 969 | 80.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:06:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE11056-PA | 430 | GE11056-PA | 1..246 | 39..286 | 1007 | 88.3 | Plus |
LP19328.hyp Sequence
Translation from 126 to 1007
> LP19328.hyp
MSSHGLAYTTRIERKSYRELQINRDQYFVTAPNEEDLVMSLSPKDTLIHT
AISQHHQVDTSTKLNTNETSTQNTVSTAAAAAVAHHHHNLSSIHHLQNLH
SQHQSTLFNSNHSTPFSVTDILSPIEESYRKLELNGNPPSPFRSNSSSSS
INSPGTLTTSTMANPYAMGTLYHSPGVQTYCGPTDNLSLAGHYTDMRNSA
SWYGSTANDPRFAISRLMSSSASGTMSHMGNMSGLAACSVSDSKPLQFPL
AQRRKRRVLFTQAQVGTYILSLLLKKKTQIFTEWKEVNLLQAK*
LP19328.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:14:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
scro-PB | 293 | CG17594-PB | 1..293 | 1..293 | 1515 | 100 | Plus |
scro-PC | 439 | CG17594-PC | 1..265 | 1..265 | 1375 | 100 | Plus |
scro-PA | 468 | CG17594-PA | 1..265 | 1..265 | 1375 | 100 | Plus |
scro-PF | 307 | CG17594-PF | 1..104 | 162..265 | 546 | 100 | Plus |