Clone LP19506 Report

Search the DGRC for LP19506

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:195
Well:6
Vector:pOT2
Associated Gene/TranscriptCG8997-RA
Protein status:LP19506.pep: gold
Sequenced Size:886

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8997 2009-02-14 Manual selection by Sue Celniker

Clone Sequence Records

LP19506.complete Sequence

886 bp assembled on 2009-07-27

GenBank Submission: BT088958.1

> LP19506.complete
TAGGTACTACGATCAGTCGGTAGGACTCTCAGTCAAAGCAATAATGAAAA
TCTTCGTGGCTATTTTGGCTTTTGTGGCCGTTGCCAGTGCGGCTTCCATG
GGCCAGCCCATTGAAACCCAGTCGATCTCCAGCACGATTGTGGATGTGAT
CGAGGGCATTAAGGAGCAGATGCCCTGTGGCTTTACCAGTGTCGGCCTGC
CGCCATTGGCTCCTCTTAGAATTGACCATCAGGATATCAACATCGATAGC
AGCGTGCTGAAGGCTCAGGGAACCATTGATCACTTCCGCCTGAACGGTCT
GAATGATTTTGATATCGATGAGATGAAGGTCAACGCCATCACCAGCAAGG
TGACCTACAAGTTCACTTTCCGCGACGTGAACGTGGATACCCAATACGAT
TTGAGTGTGCTGCTAAAGAAGTACGGATTTACCATCAATCTGATCGGTGC
CGGACATGCCAAATTCGCCATCAAGGATATGGTTATCTGGGGCACTATGA
AGTACTCACTCGGCGTGATCAGCGGCAACCTGAAGCTGAAGTCATTGGAG
GTCCGCACCCACTTGGGTGAGGTTGATTCCGAGATCGAGGGCATCCTGGG
CGATGGCAGCATCAACGAGAAGATGAATGAGTACTTGGCCGAGGCCGTGG
AGCTGGCCATCAATGAGAACGAAGATCTGATTGCCGATACCATCGAGAGT
ATTGCCCTGCCCGCCGTCAACAGCGTTCTGGACGACATCAGCATCGCCGA
GATCATCTCCGGTGCCGGTGGTGATGGTGAGGGTGGAGAGAAGGAGGCCT
GCATTCCCCCCGAGTTCGAGTGGTAAACAAATCATCGGTCATTAAACAAC
CGTTTATGAATCAAGAAAAAAAAAAAAAAAAAAAAA

LP19506.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:31:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG8997-RA 1301 CG8997-RA 97..963 1..867 4335 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:48:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13843107..13843859 865..113 3750 99.9 Minus
chr2L 23010047 chr2L 13843923..13844035 113..1 565 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:58:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:48:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13844375..13845129 867..113 3775 100 Minus
2L 23513712 2L 13845193..13845305 113..1 565 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:27:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13844375..13845129 867..113 3775 100 Minus
2L 23513712 2L 13845193..13845305 113..1 565 100 Minus
Blast to na_te.dros performed on 2019-03-15 18:48:41 has no hits.

LP19506.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:49:28 Download gff for LP19506.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13843107..13843858 114..865 99 <- Minus
chr2L 13843923..13844035 1..113 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:11:52 Download gff for LP19506.complete
Subject Subject Range Query Range Percent Splice Strand
CG8997-RA 1..783 44..826 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:00:17 Download gff for LP19506.complete
Subject Subject Range Query Range Percent Splice Strand
CG8997-RA 1..783 44..826 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:32:35 Download gff for LP19506.complete
Subject Subject Range Query Range Percent Splice Strand
CG8997-RA 1..783 44..826 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:01:54 Download gff for LP19506.complete
Subject Subject Range Query Range Percent Splice Strand
CG8997-RA 1..783 44..826 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-27 15:01:19 Download gff for LP19506.complete
Subject Subject Range Query Range Percent Splice Strand
CG8997-RA 1..826 1..826 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:00:17 Download gff for LP19506.complete
Subject Subject Range Query Range Percent Splice Strand
CG8997-RA 5..869 1..865 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:32:35 Download gff for LP19506.complete
Subject Subject Range Query Range Percent Splice Strand
CG8997-RA 21..885 1..865 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:01:54 Download gff for LP19506.complete
Subject Subject Range Query Range Percent Splice Strand
CG8997-RA 21..885 1..865 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:49:28 Download gff for LP19506.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13844377..13845128 114..865 100 <- Minus
2L 13845193..13845305 1..113 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:49:28 Download gff for LP19506.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13844377..13845128 114..865 100 <- Minus
2L 13845193..13845305 1..113 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:49:28 Download gff for LP19506.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13844377..13845128 114..865 100 <- Minus
2L 13845193..13845305 1..113 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:32:35 Download gff for LP19506.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13844377..13845128 114..865 100 <- Minus
arm_2L 13845193..13845305 1..113 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:52:00 Download gff for LP19506.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13844377..13845128 114..865 100 <- Minus
2L 13845193..13845305 1..113 100   Minus

LP19506.hyp Sequence

Translation from 0 to 825

> LP19506.hyp
RYYDQSVGLSVKAIMKIFVAILAFVAVASAASMGQPIETQSISSTIVDVI
EGIKEQMPCGFTSVGLPPLAPLRIDHQDINIDSSVLKAQGTIDHFRLNGL
NDFDIDEMKVNAITSKVTYKFTFRDVNVDTQYDLSVLLKKYGFTINLIGA
GHAKFAIKDMVIWGTMKYSLGVISGNLKLKSLEVRTHLGEVDSEIEGILG
DGSINEKMNEYLAEAVELAINENEDLIADTIESIALPAVNSVLDDISIAE
IISGAGGDGEGGEKEACIPPEFEW*

LP19506.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG8997-PB 260 CG8997-PB 1..260 15..274 1310 100 Plus
CG8997-PA 260 CG8997-PA 1..260 15..274 1310 100 Plus
CG7953-PB 297 CG7953-PB 63..296 50..274 356 34.5 Plus
CG7953-PA 297 CG7953-PA 63..296 50..274 356 34.5 Plus
CG33306-PA 244 CG33306-PA 7..238 19..253 321 30 Plus

LP19506.pep Sequence

Translation from 1 to 825

> LP19506.pep
RYYDQSVGLSVKAIMKIFVAILAFVAVASAASMGQPIETQSISSTIVDVI
EGIKEQMPCGFTSVGLPPLAPLRIDHQDINIDSSVLKAQGTIDHFRLNGL
NDFDIDEMKVNAITSKVTYKFTFRDVNVDTQYDLSVLLKKYGFTINLIGA
GHAKFAIKDMVIWGTMKYSLGVISGNLKLKSLEVRTHLGEVDSEIEGILG
DGSINEKMNEYLAEAVELAINENEDLIADTIESIALPAVNSVLDDISIAE
IISGAGGDGEGGEKEACIPPEFEW*

LP19506.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15613-PA 259 GF15613-PA 1..259 15..274 1123 83.5 Plus
Dana\GF14265-PA 296 GF14265-PA 1..280 15..260 347 30.7 Plus
Dana\GF14264-PA 287 GF14264-PA 1..262 11..253 314 31.7 Plus
Dana\GF15614-PA 242 GF15614-PA 7..242 19..258 301 32.9 Plus
Dana\GF14266-PA 250 GF14266-PA 6..234 17..253 222 23.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:16:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10175-PA 261 GG10175-PA 1..261 15..274 1142 90.8 Plus
Dere\GG23892-PA 297 GG23892-PA 1..281 15..260 352 31 Plus
Dere\GG10176-PA 244 GG10176-PA 1..238 15..253 318 32.5 Plus
Dere\GG23891-PA 287 GG23891-PA 1..262 11..253 290 28.6 Plus
Dere\GG23893-PA 250 GG23893-PA 7..242 17..261 211 23.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10611-PA 258 GH10611-PA 1..258 15..274 991 78.1 Plus
Dgri\GH11122-PA 301 GH11122-PA 59..300 42..274 387 33.3 Plus
Dgri\GH10612-PA 250 GH10612-PA 28..232 38..245 346 36.2 Plus
Dgri\GH11121-PA 278 GH11121-PA 1..278 11..272 302 29.6 Plus
Dgri\GH17470-PA 259 GH17470-PA 4..256 16..268 181 22.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG8997-PB 260 CG8997-PB 1..260 15..274 1310 100 Plus
CG8997-PA 260 CG8997-PA 1..260 15..274 1310 100 Plus
CG7953-PB 297 CG7953-PB 63..296 50..274 356 34.5 Plus
CG7953-PA 297 CG7953-PA 63..296 50..274 356 34.5 Plus
CG33306-PA 244 CG33306-PA 7..238 19..253 321 30 Plus
CG7916-PA 287 CG7916-PA 1..252 11..243 289 30.8 Plus
CG7968-PA 250 CG7968-PA 7..242 17..261 209 23.2 Plus
CG34316-PA 267 CG34316-PA 32..244 46..261 162 26.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:17:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17402-PA 256 GI17402-PA 1..256 15..273 994 74.1 Plus
Dmoj\GI12604-PA 298 GI12604-PA 56..297 42..274 378 33.1 Plus
Dmoj\GI17403-PA 245 GI17403-PA 6..239 18..252 355 33.5 Plus
Dmoj\GI12593-PA 282 GI12593-PA 46..252 42..243 301 32.4 Plus
Dmoj\GI24820-PA 259 GI24820-PA 6..255 17..267 170 21.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21075-PA 258 GL21075-PA 1..258 15..274 1036 80.8 Plus
Dper\GL21241-PA 297 GL21241-PA 63..260 50..243 351 37 Plus
Dper\GL21076-PA 245 GL21076-PA 5..238 23..253 317 32.8 Plus
Dper\GL21240-PA 287 GL21240-PA 1..262 11..253 312 29.7 Plus
Dper\GL21242-PA 250 GL21242-PA 7..234 17..253 236 25.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21464-PA 258 GA21464-PA 1..258 15..274 1029 80 Plus
Dpse\GA20716-PA 297 GA20716-PA 63..260 50..243 355 37.5 Plus
Dpse\GA29061-PA 245 GA29061-PA 5..238 23..253 318 32.8 Plus
Dpse\GA20684-PA 287 GA20684-PA 1..262 11..253 312 29.7 Plus
Dpse\GA20729-PA 250 GA20729-PA 1..234 11..253 240 25 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:17:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15045-PA 258 GM15045-PA 1..258 15..274 1289 95.4 Plus
Dsec\GM15320-PA 297 GM15320-PA 1..296 15..274 354 30 Plus
Dsec\GM15048-PA 242 GM15048-PA 1..236 15..253 325 30.3 Plus
Dsec\GM15309-PA 261 GM15309-PA 1..232 11..223 266 30 Plus
Dsec\GM15330-PA 250 GM15330-PA 7..242 17..261 221 23.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:17:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22033-PA 244 GD22033-PA 5..238 17..253 312 29.7 Plus
Dsim\GD23932-PA 287 GD23932-PA 1..262 11..253 312 31.2 Plus
Dsim\GD23933-PA 289 GD23933-PA 1..273 15..260 312 29.5 Plus
Dsim\GD23934-PA 250 GD23934-PA 28..242 48..261 216 23.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18080-PA 256 GJ18080-PA 1..256 15..274 1017 74.2 Plus
Dvir\GJ18083-PA 247 GJ18083-PA 1..244 15..257 373 36.1 Plus
Dvir\GJ18082-PA 250 GJ18082-PA 6..250 18..260 370 35.2 Plus
Dvir\GJ18152-PA 301 GJ18152-PA 59..300 42..274 368 32.6 Plus
Dvir\GJ18151-PA 282 GJ18151-PA 46..252 42..243 295 32.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15116-PA 258 GK15116-PA 1..258 15..274 1091 80 Plus
Dwil\GK15016-PA 298 GK15016-PA 64..297 50..274 346 34.2 Plus
Dwil\GK15117-PA 242 GK15117-PA 27..236 38..252 340 35.8 Plus
Dwil\GK15013-PA 287 GK15013-PA 1..262 11..253 295 29.4 Plus
Dwil\GK15017-PA 253 GK15017-PA 1..245 11..261 245 25.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11368-PA 259 GE11368-PA 1..259 15..274 1164 92.7 Plus
Dyak\GE18691-PA 297 GE18691-PA 63..281 50..260 348 35.2 Plus
Dyak\GE11373-PA 244 GE11373-PA 5..238 17..253 321 30.5 Plus
Dyak\GE18690-PA 287 GE18690-PA 1..262 11..253 311 31.7 Plus
Dyak\GE18692-PA 250 GE18692-PA 7..242 17..261 210 22.8 Plus