Clone LP19801 Report

Search the DGRC for LP19801

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:198
Well:1
Vector:pOT2
Protein status:LP19801.pep: Imported from assembly
Sequenced Size:760

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12179 2009-02-12 Manual selection by Sue Celniker

Clone Sequence Records

LP19801.complete Sequence

760 bp assembled on 2009-07-27

GenBank Submission: BT088959.1

> LP19801.complete
AAAGCAAGCCAAGATCTTGGTCTTCTGCCTTTCCCTGGGCCTCTCGCTGG
CTGTGAAGCTGCAAATTCCCTTTAGACCAGACGCCCACATCCAGGAGCTG
CAGCTGCAGAGCAGGGAGCTGGCCGAAGTCCACTCAGATCACTCCACGCA
GTGCTTCTCGATCTACAAGCCCAAATTGGCCAAAATTGCGGATCAGTTCG
AAACTAACTTTACGGCTTGCATCTCGGCCTATGACAATTGCACATCCCAT
ATCAGCGAGAAGTATGCCGAGGATCGCCAGATCCTTCTCAGGTCCGCCAA
CATCGGCTGCTCGTATCCCAACTCCAATTGCCAGGTCTGGACTCTTGAGC
AGCAGCCGCTGGACACCGTGGTCTCCCGCCTCGAATGCGCCTCCACCAAC
TCGGCCGAGAGCTCCAAGACCTTCTATGCCATTTCGGCCAATGCCACGCA
GATTGCAGTTCAGATCCAGGAGCAATATACGATCCTAGAGAGCCGGAAGA
GTGTTTGCATCAATGACGCAAATCGCTCCTATGTGGAAGACACCTCCGAT
ACCTACGAGCTTTTGAACAACTGCCTCAAGAACGGACCAACCACCACAAC
TTGTAATCCATTGACTTACCCTACAACAACCACAGCAACAACAACAACAA
CAACAATAACAACCGCAGCACCTTTACTTCGTTAAAAGAAAGTCAATCAA
TAAATATATCAGGCAATTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAA

LP19801.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:31:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG11470-RA 770 CG11470-RA 9..729 1..721 3605 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:23:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25411613..25412328 719..1 3485 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:58:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:23:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29589034..29589754 721..1 3605 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:27:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29329865..29330585 721..1 3605 100 Minus
Blast to na_te.dros performed on 2019-03-16 11:23:34 has no hits.

LP19801.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:24:43 Download gff for LP19801.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25411613..25412328 1..719 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:11:52 Download gff for LP19801.complete
Subject Subject Range Query Range Percent Splice Strand
CG11470-RA 9..693 1..685 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:00:18 Download gff for LP19801.complete
Subject Subject Range Query Range Percent Splice Strand
CG11470-RA 9..693 1..685 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:28:37 Download gff for LP19801.complete
Subject Subject Range Query Range Percent Splice Strand
CG11470-RA 9..693 1..685 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:15:20 Download gff for LP19801.complete
Subject Subject Range Query Range Percent Splice Strand
CG11470-RA 9..693 1..685 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-27 15:05:40 Download gff for LP19801.complete
Subject Subject Range Query Range Percent Splice Strand
CG11470-RA 9..727 1..719 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:00:18 Download gff for LP19801.complete
Subject Subject Range Query Range Percent Splice Strand
CG11470-RA 9..727 1..719 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:28:37 Download gff for LP19801.complete
Subject Subject Range Query Range Percent Splice Strand
CG11470-RA 9..727 1..719 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:15:20 Download gff for LP19801.complete
Subject Subject Range Query Range Percent Splice Strand
CG11470-RA 9..727 1..719 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:24:43 Download gff for LP19801.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29589036..29589754 1..719 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:24:43 Download gff for LP19801.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29589036..29589754 1..719 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:24:43 Download gff for LP19801.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29589036..29589754 1..719 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:28:37 Download gff for LP19801.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25414758..25415476 1..719 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:52:01 Download gff for LP19801.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29329867..29330585 1..719 100   Minus

LP19801.hyp Sequence

Translation from 0 to 684

> LP19801.hyp
KQAKILVFCLSLGLSLAVKLQIPFRPDAHIQELQLQSRELAEVHSDHSTQ
CFSIYKPKLAKIADQFETNFTACISAYDNCTSHISEKYAEDRQILLRSAN
IGCSYPNSNCQVWTLEQQPLDTVVSRLECASTNSAESSKTFYAISANATQ
IAVQIQEQYTILESRKSVCINDANRSYVEDTSDTYELLNNCLKNGPTTTT
CNPLTYPTTTTATTTTTTITTAAPLLR*

LP19801.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG11470-PB 230 CG11470-PB 4..230 1..227 1172 100 Plus
CG11470-PA 230 CG11470-PA 4..230 1..227 1172 100 Plus
CG7567-PA 211 CG7567-PA 9..210 3..209 223 30.7 Plus
CG5767-PA 253 CG5767-PA 7..236 7..224 221 28.6 Plus
CG10911-PA 359 CG10911-PA 4..216 4..223 217 23.8 Plus

LP19801.pep Sequence

Translation from 1 to 684

> LP19801.pep
KQAKILVFCLSLGLSLAVKLQIPFRPDAHIQELQLQSRELAEVHSDHSTQ
CFSIYKPKLAKIADQFETNFTACISAYDNCTSHISEKYAEDRQILLRSAN
IGCSYPNSNCQVWTLEQQPLDTVVSRLECASTNSAESSKTFYAISANATQ
IAVQIQEQYTILESRKSVCINDANRSYVEDTSDTYELLNNCLKNGPTTTT
CNPLTYPTTTTATTTTTTITTAAPLLR*

LP19801.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:17:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23352-PA 223 GF23352-PA 4..194 1..194 436 45.1 Plus
Dana\GF13208-PA 377 GF13208-PA 4..220 4..224 259 32.5 Plus
Dana\GF22881-PA 228 GF22881-PA 11..197 5..196 223 28.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:17:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12013-PA 233 GG12013-PA 4..207 1..204 940 85.8 Plus
Dere\GG12014-PA 210 GG12014-PA 9..197 3..196 242 34 Plus
Dere\GG20997-PA 383 GG20997-PA 9..190 5..197 192 27.5 Plus
Dere\GG21000-PA 300 GG21000-PA 7..188 7..195 165 26.8 Plus
Dere\GG21002-PA 211 GG21002-PA 19..203 25..211 148 29.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:17:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20448-PA 278 GH20448-PA 4..192 4..208 218 27.3 Plus
Dgri\GH20454-PA 246 GH20454-PA 23..207 17..225 199 28.6 Plus
Dgri\GH20449-PA 205 GH20449-PA 4..193 4..205 187 26.7 Plus
Dgri\GH20451-PA 184 GH20451-PA 15..178 44..222 158 25.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG11470-PB 230 CG11470-PB 4..230 1..227 1172 100 Plus
CG11470-PA 230 CG11470-PA 4..230 1..227 1172 100 Plus
CG7567-PA 211 CG7567-PA 9..210 3..209 223 30.7 Plus
CG5767-PA 253 CG5767-PA 7..236 7..224 221 28.6 Plus
CG10911-PA 359 CG10911-PA 4..216 4..223 217 23.8 Plus
CG16762-PA 254 CG16762-PA 19..229 5..224 203 27.3 Plus
CG5770-PA 213 CG5770-PA 7..205 5..213 199 27.5 Plus
CG10912-PA 271 CG10912-PA 29..223 28..224 157 21.4 Plus
Muc55B-PB 485 CG5765-PB 5..218 6..225 156 25.3 Plus
Muc55B-PA 485 CG5765-PA 5..218 6..225 156 25.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:17:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24461-PA 231 GI24461-PA 7..202 5..203 331 39.7 Plus
Dmoj\GI24462-PA 213 GI24462-PA 7..206 6..220 261 34.4 Plus
Dmoj\GI19278-PA 253 GI19278-PA 3..203 3..210 210 27 Plus
Dmoj\GI19281-PA 230 GI19281-PA 4..211 8..216 192 30.1 Plus
Dmoj\GI24460-PA 223 GI24460-PA 3..213 3..213 148 26.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13586-PA 221 GL13586-PA 4..218 1..217 423 41.4 Plus
Dper\GL13587-PA 220 GL13587-PA 23..188 19..195 264 38.2 Plus
Dper\GL10540-PA 356 GL10540-PA 3..200 3..214 207 26.9 Plus
Dper\GL10543-PA 256 GL10543-PA 45..222 43..224 141 27.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:17:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26833-PA 221 GA26833-PA 4..215 1..210 416 41.9 Plus
Dpse\GA26834-PA 218 GA26834-PA 23..188 19..195 264 38.5 Plus
Dpse\GA10635-PA 372 GA10635-PA 3..200 3..214 197 26.9 Plus
Dpse\GA19113-PA 256 GA19113-PA 44..222 42..224 143 27.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:17:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12238-PA 236 GM12238-PA 4..215 1..212 1059 93.4 Plus
Dsec\GM12239-PA 211 GM12239-PA 9..198 3..197 241 33 Plus
Dsec\GM19931-PA 366 GM19931-PA 4..189 4..196 189 26 Plus
Dsec\GM19934-PA 253 GM19934-PA 8..230 14..223 153 29.7 Plus
Dsec\GM19935-PA 212 GM19935-PA 8..204 14..213 151 27.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17726-PA 236 GD17726-PA 4..215 1..212 1063 94.3 Plus
Dsim\GD17731-PA 199 GD17731-PA 18..186 19..197 218 32.4 Plus
Dsim\GD25420-PA 381 GD25420-PA 4..189 4..196 208 27.6 Plus
Dsim\GD25424-PA 212 GD25424-PA 8..204 14..213 180 28.3 Plus
Dsim\GD25423-PA 253 GD25423-PA 8..230 14..223 153 29.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10551-PA 211 GJ10551-PA 7..208 5..218 317 36.4 Plus
Dvir\GJ10552-PA 206 GJ10552-PA 20..205 19..216 252 35.7 Plus
Dvir\GJ22155-PA 276 GJ22155-PA 4..184 4..194 237 28.8 Plus
Dvir\GJ10550-PA 211 GJ10550-PA 4..196 4..203 185 26.5 Plus
Dvir\GJ22158-PA 248 GJ22158-PA 12..216 17..217 185 30.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17899-PA 237 GK17899-PA 7..229 5..226 303 31.3 Plus
Dwil\GK11180-PA 229 GK11180-PA 7..206 5..203 283 32.9 Plus
Dwil\GK22059-PA 340 GK22059-PA 7..180 6..194 223 29.1 Plus
Dwil\GK10322-PA 198 GK10322-PA 8..193 6..199 174 27.3 Plus
Dwil\GK10308-PA 199 GK10308-PA 3..193 3..199 166 26.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10449-PA 225 GE10449-PA 4..198 1..195 904 84.6 Plus
Dyak\GE10450-PA 211 GE10450-PA 10..211 3..218 237 31.7 Plus
Dyak\GE13940-PA 406 GE13940-PA 2..189 2..196 200 26.3 Plus
Dyak\GE13943-PA 274 GE13943-PA 8..188 14..195 162 28 Plus