Clone LP19941 Report

Search the DGRC for LP19941

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:199
Well:41
Vector:pOT2
Associated Gene/TranscriptCG13616-RA
Protein status:LP19941.pep: gold
Sequenced Size:747

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13616 2003-01-01 Sim4 clustering to Release 3
CG13616 2004-03-05 Blastp of sequenced clone
CG13616 2008-04-29 Release 5.5 accounting
CG13616 2008-08-15 Release 5.9 accounting
CG13616 2008-12-18 5.12 accounting

Clone Sequence Records

LP19941.complete Sequence

747 bp (747 high quality bases) assembled on 2004-03-05

GenBank Submission: BT012309

> LP19941.complete
TTCTACCGACAGCATGAGGCTCTCTCGAACTGGCCACTTCAGTTTGCTGG
CACTTTGCCTCCTGCTGCACGAGGTGCAATCCCAGGTGATGTCCATGTCA
TCAGCTGCCAACCGGACAGGGGAGGTGACCAAAGTTCTGCGCCGGCACAA
GCGTTATCTGGCATTTCCGGAGGGCTCATCGGTTTCGGGCGCCGTTTGCA
TGACGATCGGCATGATTGGCAATCCAGATGTTGACTATCTCAGCTGGGCG
GTCAACTGGGGCGTGGCATACGATCTGCCCAACCATCAGTGGGTCATCCA
ACACGCCCATGGACTGAACGCCACCCTGGCCAAGGATACCATTAAGCGGC
GATCCCGGCGAGCTTTTTACGATGAGGTGCAGTCTTTATTTGATAACATG
GGTTTCAATGGTCGTTCGTGTGTGGCTCGAGCTCTATGCGAAAGTGCCAA
GTTCATGTTGCCGTCGGTGGAACGGGGAAACATGTTGCAGGAGTTGGTCA
GGACTGTCTTTAGCCTGCCTCCCTCCCCGGTGGCTGCCCACGAACCACAA
GCCCATCATCAGTATGATCGAATCTACCGTCGATCCAAGCGGAGCTCACG
GGATTGCCATGAAATCTATCCAGGATGTCAGTTTTCACTACTGGCTTTGG
CATTGGGCAAATATATGGCGGCCACAACCACGAAGTTTAGTTCATTTAAC
TATATGTGAAAGAAAAAATGATTTAATTGAAAAAAAAAAAAAAAAAA

LP19941.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:55:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG13616-RA 860 CG13616-RA 97..843 1..747 3705 99.7 Plus
CG13616.a 784 CG13616.a 30..778 1..747 3660 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:03:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20216771..20217103 397..729 1665 100 Plus
chr3R 27901430 chr3R 20216500..20216709 187..396 1050 100 Plus
chr3R 27901430 chr3R 20216251..20216438 1..188 940 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:58:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24393430..24393780 397..747 1725 99.4 Plus
3R 32079331 3R 24393159..24393368 187..396 1050 100 Plus
3R 32079331 3R 24392910..24393097 1..188 940 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:44:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24134261..24134611 397..747 1725 99.4 Plus
3R 31820162 3R 24133990..24134199 187..396 1050 100 Plus
3R 31820162 3R 24133741..24133928 1..188 940 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:03:13 has no hits.

LP19941.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:03:53 Download gff for LP19941.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20216251..20216437 1..187 100 -> Plus
chr3R 20216501..20216709 188..396 100 -> Plus
chr3R 20216771..20217103 397..729 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:43:50 Download gff for LP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG13616-RA 1..696 14..709 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:29:11 Download gff for LP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG13616-RA 1..696 14..709 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:05:52 Download gff for LP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG13616-RA 1..696 14..709 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:13:08 Download gff for LP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG13616-RA 1..696 14..709 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:14:19 Download gff for LP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG13616-RA 1..696 14..709 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:33:00 Download gff for LP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG13616-RA 1..729 1..729 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:29:11 Download gff for LP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG13616-RA 1..729 1..729 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:05:52 Download gff for LP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG13616-RA 22..750 1..729 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:13:09 Download gff for LP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG13616-RA 1..729 1..729 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:14:19 Download gff for LP19941.complete
Subject Subject Range Query Range Percent Splice Strand
CG13616-RA 22..750 1..729 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:53 Download gff for LP19941.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24392910..24393096 1..187 100 -> Plus
3R 24393160..24393368 188..396 100 -> Plus
3R 24393430..24393762 397..729 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:53 Download gff for LP19941.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24392910..24393096 1..187 100 -> Plus
3R 24393160..24393368 188..396 100 -> Plus
3R 24393430..24393762 397..729 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:53 Download gff for LP19941.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24392910..24393096 1..187 100 -> Plus
3R 24393160..24393368 188..396 100 -> Plus
3R 24393430..24393762 397..729 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:05:52 Download gff for LP19941.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20218632..20218818 1..187 100 -> Plus
arm_3R 20218882..20219090 188..396 100 -> Plus
arm_3R 20219152..20219484 397..729 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:49:48 Download gff for LP19941.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24133991..24134199 188..396 100 -> Plus
3R 24134261..24134593 397..729 100   Plus
3R 24133741..24133927 1..187 100 -> Plus

LP19941.hyp Sequence

Translation from 0 to 708

> LP19941.hyp
STDSMRLSRTGHFSLLALCLLLHEVQSQVMSMSSAANRTGEVTKVLRRHK
RYLAFPEGSSVSGAVCMTIGMIGNPDVDYLSWAVNWGVAYDLPNHQWVIQ
HAHGLNATLAKDTIKRRSRRAFYDEVQSLFDNMGFNGRSCVARALCESAK
FMLPSVERGNMLQELVRTVFSLPPSPVAAHEPQAHHQYDRIYRRSKRSSR
DCHEIYPGCQFSLLALALGKYMAATTTKFSSFNYM*

LP19941.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:59:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG13616-PA 231 CG13616-PA 1..231 5..235 1214 100 Plus
CG5768-PC 262 CG5768-PC 80..253 46..221 411 47.8 Plus
CG5768-PD 262 CG5768-PD 80..253 46..221 405 46.7 Plus
CG13616-PB 63 CG13616-PB 1..60 5..64 287 98.3 Plus

LP19941.pep Sequence

Translation from 13 to 708

> LP19941.pep
MRLSRTGHFSLLALCLLLHEVQSQVMSMSSAANRTGEVTKVLRRHKRYLA
FPEGSSVSGAVCMTIGMIGNPDVDYLSWAVNWGVAYDLPNHQWVIQHAHG
LNATLAKDTIKRRSRRAFYDEVQSLFDNMGFNGRSCVARALCESAKFMLP
SVERGNMLQELVRTVFSLPPSPVAAHEPQAHHQYDRIYRRSKRSSRDCHE
IYPGCQFSLLALALGKYMAATTTKFSSFNYM*

LP19941.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20751-PA 200 GF20751-PA 1..197 1..195 802 77.5 Plus
Dana\GF20713-PA 260 GF20713-PA 78..251 42..217 418 46.1 Plus
Dana\GF20716-PA 445 GF20716-PA 346..440 112..211 148 34 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11293-PA 233 GG11293-PA 1..233 1..231 1119 93.1 Plus
Dere\GG12344-PA 401 GG12344-PA 217..392 40..217 434 48.9 Plus
Dere\GG12344-PA 401 GG12344-PA 84..173 40..128 269 54.4 Plus
Dere\GG12347-PA 475 GG12347-PA 376..468 112..209 150 35.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18821-PA 233 GH18821-PA 27..233 23..231 801 68.9 Plus
Dgri\GH18788-PA 437 GH18788-PA 248..427 37..217 431 45.9 Plus
Dgri\GH23842-PA 403 GH23842-PA 263..403 118..231 277 43.4 Plus
Dgri\GH18788-PA 437 GH18788-PA 86..174 42..127 248 52.8 Plus
Dgri\GH23580-PA 175 GH23580-PA 86..174 42..127 247 52.8 Plus
Dgri\GH24022-PA 215 GH24022-PA 116..208 112..209 144 33.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG13616-PA 231 CG13616-PA 1..231 1..231 1214 100 Plus
CG5768-PC 262 CG5768-PC 80..253 42..217 411 47.8 Plus
CG5768-PD 262 CG5768-PD 80..253 42..217 405 46.7 Plus
CG13616-PB 63 CG13616-PB 1..60 1..60 287 98.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10080-PA 230 GI10080-PA 1..230 3..231 805 64.3 Plus
Dmoj\GI22678-PA 417 GI22678-PA 233..407 42..217 434 49.2 Plus
Dmoj\GI22678-PA 417 GI22678-PA 89..182 40..130 251 48.9 Plus
Dmoj\GI22681-PA 426 GI22681-PA 327..419 112..209 152 35.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21866-PA 244 GL21866-PA 30..244 20..231 968 80.9 Plus
Dper\GL21979-PA 408 GL21979-PA 222..398 40..217 436 48.4 Plus
Dper\GL21979-PA 408 GL21979-PA 87..176 42..130 272 55.6 Plus
Dper\GL21982-PA 527 GL21982-PA 427..520 112..209 157 35.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12409-PA 244 GA12409-PA 30..244 20..231 951 79.5 Plus
Dpse\GA27332-PB 281 GA27332-PB 97..271 42..217 433 49.4 Plus
Dpse\GA27332-PA 281 GA27332-PA 97..271 42..217 418 47.2 Plus
Dpse\GA14664-PA 527 GA14664-PA 427..520 112..209 156 35.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26599-PA 234 GM26599-PA 1..234 1..231 1207 95.7 Plus
Dsec\GM23484-PA 397 GM23484-PA 213..388 40..217 418 46.7 Plus
Dsec\GM23484-PA 397 GM23484-PA 78..167 40..128 272 55.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18290-PA 411 GD18290-PA 227..402 40..217 422 47.3 Plus
Dsim\GD18290-PA 411 GD18290-PA 92..234 40..193 275 41.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23816-PA 230 GJ23816-PA 33..230 32..231 817 74.5 Plus
Dvir\GJ23405-PA 274 GJ23405-PA 86..264 40..217 427 48.4 Plus
Dvir\GJ23409-PA 463 GJ23409-PA 364..456 112..209 147 34.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22340-PA 226 GK22340-PA 6..226 8..231 775 65.5 Plus
Dwil\GK22822-PA 423 GK22822-PA 240..414 42..217 417 46.1 Plus
Dwil\GK22822-PA 423 GK22822-PA 33..140 22..129 279 50.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23485-PA 234 GE23485-PA 1..234 1..231 1142 94.4 Plus
Dyak\GE10797-PA 393 GE10797-PA 209..384 40..217 430 48.4 Plus
Dyak\GE10797-PA 393 GE10797-PA 80..216 40..193 276 41.3 Plus