BDGP Sequence Production Resources |
Search the DGRC for LP20105
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 201 |
Well: | 5 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34215-RA |
Protein status: | LP20105.pep: gold |
Sequenced Size: | 444 |
Gene | Date | Evidence |
---|---|---|
CG34215 | 2008-04-29 | Release 5.5 accounting |
CG34215 | 2008-08-15 | Release 5.9 accounting |
CG34215 | 2008-12-18 | 5.12 accounting |
444 bp assembled on 2007-12-07
GenBank Submission: BT031338
> LP20105.complete AAGGCTCCAAGATGCGTTCATCTACCGTGCTACTTGCGGCAATCGCCGTT CTCTTAGTTTCGGGCTACGAAGCTGCCGTTGTCCGAGGCGTCTTCGAGGA TCCAACCCATCCTGGAAAGTGTGTTCTCGAGGGTTTGGTTCTTGAAAAAG GTCAAAGTGCACGCCACCCACAGAGGTGTGAGCGAATCATATGCGGAGAA AATAGTGCGGCAGAAATCCAATCATGTGGTGCCTATGGACTTCCCCCCGG CAAAAAGTTTGGAAAGTACACAAACCCAAACGCAGATTACCCTGATTGCT GTAATCGTGAGATTATCAACCAGTAATTCCGTTTTGAAGAAAACAAAATT GAGCTCAAATCAATAAAAACATTACAAAGCGAAACGAATTAATAAAATCA CTAAGTGTGAATATTAAGAACACCAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34215-RA | 831 | CG34215-RA | 158..582 | 1..425 | 2125 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mdg1 | 7480 | mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). | 6829..6880 | 335..385 | 113 | 71.2 | Plus |
TAHRE | 10463 | TAHRE OSV 10463bp | 22..91 | 352..419 | 111 | 64.3 | Plus |
accord | 7404 | accord ACCORD 7404bp | 1065..1117 | 356..409 | 105 | 70.9 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 2718840..2719062 | 1..223 | 99 | Minus | |
chr2R | 2718585..2718785 | 224..424 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34215-RA | 1..315 | 12..326 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34215-RA | 1..315 | 12..326 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34215-RA | 1..315 | 12..326 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34215-RA | 1..315 | 12..326 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34215-RA | 1..315 | 12..326 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34215-RA | 19..441 | 1..423 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34215-RA | 19..441 | 1..423 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34215-RA | 21..444 | 1..424 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34215-RA | 19..441 | 1..423 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34215-RA | 21..444 | 1..424 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6831296..6831496 | 224..424 | 100 | <- | Minus |
2R | 6831551..6831773 | 1..223 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6831296..6831496 | 224..424 | 100 | <- | Minus |
2R | 6831551..6831773 | 1..223 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6831296..6831496 | 224..424 | 100 | <- | Minus |
2R | 6831551..6831773 | 1..223 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 2718801..2719001 | 224..424 | 100 | <- | Minus |
arm_2R | 2719056..2719278 | 1..223 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6832750..6832972 | 1..223 | 100 | Minus | |
2R | 6832495..6832695 | 224..424 | 100 | <- | Minus |
Translation from 2 to 325
> LP20105.hyp GSKMRSSTVLLAAIAVLLVSGYEAAVVRGVFEDPTHPGKCVLEGLVLEKG QSARHPQRCERIICGENSAAEIQSCGAYGLPPGKKFGKYTNPNADYPDCC NREIINQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34215-PA | 104 | CG34215-PA | 1..104 | 4..107 | 554 | 100 | Plus |
CG34177-PA | 107 | CG34177-PA | 5..105 | 7..105 | 203 | 39.6 | Plus |
CG2444-PB | 114 | CG2444-PB | 11..107 | 9..103 | 136 | 32 | Plus |
CG2444-PA | 114 | CG2444-PA | 11..107 | 9..103 | 136 | 32 | Plus |
Translation from 2 to 325
> LP20105.pep GSKMRSSTVLLAAIAVLLVSGYEAAVVRGVFEDPTHPGKCVLEGLVLEKG QSARHPQRCERIICGENSAAEIQSCGAYGLPPGKKFGKYTNPNADYPDCC NREIINQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21200-PA | 107 | GF21200-PA | 21..105 | 23..105 | 154 | 37.6 | Plus |
Dana\GF21439-PA | 114 | GF21439-PA | 8..107 | 7..103 | 136 | 34.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG25002-PA | 107 | GG25002-PA | 4..105 | 5..105 | 188 | 36.9 | Plus |
Dere\GG18842-PA | 113 | GG18842-PA | 8..106 | 11..103 | 135 | 36.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10127-PA | 109 | GH10127-PA | 15..106 | 15..105 | 198 | 46.2 | Plus |
Dgri\GH24561-PA | 114 | GH24561-PA | 2..106 | 2..102 | 168 | 33.3 | Plus |
Dgri\GH11662-PA | 111 | GH11662-PA | 1..98 | 4..100 | 164 | 38.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34215-PA | 104 | CG34215-PA | 1..104 | 4..107 | 554 | 100 | Plus |
CG34177-PA | 107 | CG34177-PA | 5..105 | 7..105 | 203 | 39.6 | Plus |
CG2444-PB | 114 | CG2444-PB | 11..107 | 9..103 | 136 | 32 | Plus |
CG2444-PA | 114 | CG2444-PA | 11..107 | 9..103 | 136 | 32 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22128-PA | 112 | GI22128-PA | 25..109 | 23..105 | 236 | 55.3 | Plus |
Dmoj\GI22106-PA | 175 | GI22106-PA | 91..165 | 30..105 | 179 | 50 | Plus |
Dmoj\GI16321-PA | 114 | GI16321-PA | 2..107 | 2..103 | 174 | 35.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15427-PA | 106 | GL15427-PA | 2..105 | 3..106 | 354 | 58.7 | Plus |
Dper\GL15237-PA | 112 | GL15237-PA | 2..105 | 2..103 | 165 | 32.7 | Plus |
Dper\GL15154-PA | 187 | GL15154-PA | 84..185 | 9..105 | 140 | 28.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA26063-PA | 106 | GA26063-PA | 2..105 | 3..106 | 354 | 58.7 | Plus |
Dpse\GA15367-PA | 112 | GA15367-PA | 2..105 | 2..103 | 161 | 31.7 | Plus |
Dpse\GA25544-PA | 187 | GA25544-PA | 84..185 | 9..105 | 141 | 28.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM13054-PA | 114 | GM13054-PA | 23..107 | 21..103 | 131 | 35.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19996-PA | 111 | GJ19996-PA | 24..108 | 23..105 | 239 | 55.3 | Plus |
Dvir\GJ17737-PA | 111 | GJ17737-PA | 1..98 | 4..100 | 170 | 38.4 | Plus |
Dvir\GJ19985-PA | 110 | GJ19985-PA | 24..108 | 24..105 | 156 | 38.8 | Plus |
Dvir\GJ15661-PA | 122 | GJ15661-PA | 18..114 | 10..102 | 147 | 32 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19793-PA | 115 | GK19793-PA | 2..108 | 6..103 | 161 | 37.4 | Plus |
Dwil\GK24349-PA | 105 | GK24349-PA | 28..103 | 32..105 | 141 | 38.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17607-PA | 115 | GE17607-PA | 19..108 | 16..103 | 142 | 35.6 | Plus |