Clone LP20105 Report

Search the DGRC for LP20105

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:201
Well:5
Vector:pOT2
Associated Gene/TranscriptCG34215-RA
Protein status:LP20105.pep: gold
Sequenced Size:444

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34215 2008-04-29 Release 5.5 accounting
CG34215 2008-08-15 Release 5.9 accounting
CG34215 2008-12-18 5.12 accounting

Clone Sequence Records

LP20105.complete Sequence

444 bp assembled on 2007-12-07

GenBank Submission: BT031338

> LP20105.complete
AAGGCTCCAAGATGCGTTCATCTACCGTGCTACTTGCGGCAATCGCCGTT
CTCTTAGTTTCGGGCTACGAAGCTGCCGTTGTCCGAGGCGTCTTCGAGGA
TCCAACCCATCCTGGAAAGTGTGTTCTCGAGGGTTTGGTTCTTGAAAAAG
GTCAAAGTGCACGCCACCCACAGAGGTGTGAGCGAATCATATGCGGAGAA
AATAGTGCGGCAGAAATCCAATCATGTGGTGCCTATGGACTTCCCCCCGG
CAAAAAGTTTGGAAAGTACACAAACCCAAACGCAGATTACCCTGATTGCT
GTAATCGTGAGATTATCAACCAGTAATTCCGTTTTGAAGAAAACAAAATT
GAGCTCAAATCAATAAAAACATTACAAAGCGAAACGAATTAATAAAATCA
CTAAGTGTGAATATTAAGAACACCAAAAAAAAAAAAAAAAAAAA

LP20105.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG34215-RA 831 CG34215-RA 158..582 1..425 2125 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:07:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2718840..2719062 223..1 1100 99.6 Minus
chr2R 21145070 chr2R 2718585..2718785 424..224 1005 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:58:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:07:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6831551..6831773 223..1 1115 100 Minus
2R 25286936 2R 6831295..6831496 425..224 1010 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:04:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6832750..6832972 223..1 1115 100 Minus
2R 25260384 2R 6832494..6832695 425..224 1010 100 Minus
Blast to na_te.dros performed 2019-03-17 00:07:30
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 6829..6880 335..385 113 71.2 Plus
TAHRE 10463 TAHRE OSV 10463bp 22..91 352..419 111 64.3 Plus
accord 7404 accord ACCORD 7404bp 1065..1117 356..409 105 70.9 Plus

LP20105.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:08:18 Download gff for LP20105.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2718840..2719062 1..223 99   Minus
chr2R 2718585..2718785 224..424 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:43:53 Download gff for LP20105.complete
Subject Subject Range Query Range Percent Splice Strand
CG34215-RA 1..315 12..326 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:44:43 Download gff for LP20105.complete
Subject Subject Range Query Range Percent Splice Strand
CG34215-RA 1..315 12..326 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:30:59 Download gff for LP20105.complete
Subject Subject Range Query Range Percent Splice Strand
CG34215-RA 1..315 12..326 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:35:25 Download gff for LP20105.complete
Subject Subject Range Query Range Percent Splice Strand
CG34215-RA 1..315 12..326 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:13:01 Download gff for LP20105.complete
Subject Subject Range Query Range Percent Splice Strand
CG34215-RA 1..315 12..326 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:28:39 Download gff for LP20105.complete
Subject Subject Range Query Range Percent Splice Strand
CG34215-RA 19..441 1..423 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:44:43 Download gff for LP20105.complete
Subject Subject Range Query Range Percent Splice Strand
CG34215-RA 19..441 1..423 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:30:59 Download gff for LP20105.complete
Subject Subject Range Query Range Percent Splice Strand
CG34215-RA 21..444 1..424 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:35:26 Download gff for LP20105.complete
Subject Subject Range Query Range Percent Splice Strand
CG34215-RA 19..441 1..423 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:13:01 Download gff for LP20105.complete
Subject Subject Range Query Range Percent Splice Strand
CG34215-RA 21..444 1..424 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:08:18 Download gff for LP20105.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6831296..6831496 224..424 100 <- Minus
2R 6831551..6831773 1..223 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:08:18 Download gff for LP20105.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6831296..6831496 224..424 100 <- Minus
2R 6831551..6831773 1..223 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:08:18 Download gff for LP20105.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6831296..6831496 224..424 100 <- Minus
2R 6831551..6831773 1..223 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:30:59 Download gff for LP20105.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2718801..2719001 224..424 100 <- Minus
arm_2R 2719056..2719278 1..223 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:30:24 Download gff for LP20105.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6832750..6832972 1..223 100   Minus
2R 6832495..6832695 224..424 100 <- Minus

LP20105.hyp Sequence

Translation from 2 to 325

> LP20105.hyp
GSKMRSSTVLLAAIAVLLVSGYEAAVVRGVFEDPTHPGKCVLEGLVLEKG
QSARHPQRCERIICGENSAAEIQSCGAYGLPPGKKFGKYTNPNADYPDCC
NREIINQ*

LP20105.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG34215-PA 104 CG34215-PA 1..104 4..107 554 100 Plus
CG34177-PA 107 CG34177-PA 5..105 7..105 203 39.6 Plus
CG2444-PB 114 CG2444-PB 11..107 9..103 136 32 Plus
CG2444-PA 114 CG2444-PA 11..107 9..103 136 32 Plus

LP20105.pep Sequence

Translation from 2 to 325

> LP20105.pep
GSKMRSSTVLLAAIAVLLVSGYEAAVVRGVFEDPTHPGKCVLEGLVLEKG
QSARHPQRCERIICGENSAAEIQSCGAYGLPPGKKFGKYTNPNADYPDCC
NREIINQ*

LP20105.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:32:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21200-PA 107 GF21200-PA 21..105 23..105 154 37.6 Plus
Dana\GF21439-PA 114 GF21439-PA 8..107 7..103 136 34.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25002-PA 107 GG25002-PA 4..105 5..105 188 36.9 Plus
Dere\GG18842-PA 113 GG18842-PA 8..106 11..103 135 36.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10127-PA 109 GH10127-PA 15..106 15..105 198 46.2 Plus
Dgri\GH24561-PA 114 GH24561-PA 2..106 2..102 168 33.3 Plus
Dgri\GH11662-PA 111 GH11662-PA 1..98 4..100 164 38.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG34215-PA 104 CG34215-PA 1..104 4..107 554 100 Plus
CG34177-PA 107 CG34177-PA 5..105 7..105 203 39.6 Plus
CG2444-PB 114 CG2444-PB 11..107 9..103 136 32 Plus
CG2444-PA 114 CG2444-PA 11..107 9..103 136 32 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:32:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22128-PA 112 GI22128-PA 25..109 23..105 236 55.3 Plus
Dmoj\GI22106-PA 175 GI22106-PA 91..165 30..105 179 50 Plus
Dmoj\GI16321-PA 114 GI16321-PA 2..107 2..103 174 35.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:32:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15427-PA 106 GL15427-PA 2..105 3..106 354 58.7 Plus
Dper\GL15237-PA 112 GL15237-PA 2..105 2..103 165 32.7 Plus
Dper\GL15154-PA 187 GL15154-PA 84..185 9..105 140 28.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26063-PA 106 GA26063-PA 2..105 3..106 354 58.7 Plus
Dpse\GA15367-PA 112 GA15367-PA 2..105 2..103 161 31.7 Plus
Dpse\GA25544-PA 187 GA25544-PA 84..185 9..105 141 28.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13054-PA 114 GM13054-PA 23..107 21..103 131 35.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:32:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19996-PA 111 GJ19996-PA 24..108 23..105 239 55.3 Plus
Dvir\GJ17737-PA 111 GJ17737-PA 1..98 4..100 170 38.4 Plus
Dvir\GJ19985-PA 110 GJ19985-PA 24..108 24..105 156 38.8 Plus
Dvir\GJ15661-PA 122 GJ15661-PA 18..114 10..102 147 32 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:32:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19793-PA 115 GK19793-PA 2..108 6..103 161 37.4 Plus
Dwil\GK24349-PA 105 GK24349-PA 28..103 32..105 141 38.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:32:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17607-PA 115 GE17607-PA 19..108 16..103 142 35.6 Plus