Clone LP20351 Report

Search the DGRC for LP20351

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:203
Well:51
Vector:pOT2
Associated Gene/TranscriptCG14292-RA
Protein status:LP20351.pep: gold
Sequenced Size:673

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14292-RA 2009-01-21 est gleaning

Clone Sequence Records

LP20351.complete Sequence

673 bp assembled on 2009-02-10

GenBank Submission: BT058089.1

> LP20351.complete
CGAAACCCAACGACTGAGAACCAAGTGAACTCAGATAAATTAAAAGAAAT
GAAATTCGCAATTGTTCTACTGGCGGCCAGCATTGCCTGCATCAGTGCAC
AGGGCCCTGGAGCTACTGTTGGAAATCCCCTTGCCGGAAATCCCTTTGCC
GCCGCCAATCCGTATGCGGCTGCCTTTAATCCCTTCCTAAATGGAATTTT
CGGAGGTGCTGGCACAGGAGCTGCCGCCGGTGTAGCCGCTCCCGTGGCAC
CGTCTGCTCCCTTTGGAGGCGCCTCGATTTCCTCATTCTTCCAGTCGATA
GTCCTGCAACGCGAAGCCGAGCGTCTGCTCTCCCAGCCTGACTTTCCCGC
CGACCTGGCGGAGCGCGTCCTGGATGTGGTGGCCACCTCGGAGGAGTCGA
TCAGTGGCTGCAACAACGCCACTTTGCCCTGGCTGCAGATACGCTGTGTC
AAGCCTCTGCTGACCACGGCCAAGAACCAGCTGAAGGCCATCGATGACGA
GTGGCAGGCCCGTTTGGCCGCCACCGCCAGTCCCACAGGAGCAGCTGCTG
CCTAGGATTCTAGTCCTGTCCTCCGGCTGCCTTAGTGTCCAATACTTCCT
AGCTTAGCAATCGACCAACATAGATGCAATAAAATTTAAATAAGCCTAAA
AAAAAAAAAAAAAAAAAAAAAAA

LP20351.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG14292-RA 774 CG14292-RA 89..737 1..649 3245 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:12:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14728920..14729466 647..101 2600 98.4 Minus
chr3R 27901430 chr3R 14729539..14729641 103..1 500 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:58:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18904931..18905479 649..101 2745 100 Minus
3R 32079331 3R 18905552..18905654 103..1 515 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:40:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18645762..18646310 649..101 2745 100 Minus
3R 31820162 3R 18646383..18646485 103..1 515 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:12:01 has no hits.

LP20351.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:13:19 Download gff for LP20351.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14728920..14729464 103..647 98 <- Minus
chr3R 14729540..14729641 1..102 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:30 Download gff for LP20351.complete
Subject Subject Range Query Range Percent Splice Strand
CG14292-RA 1..507 49..555 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:34:30 Download gff for LP20351.complete
Subject Subject Range Query Range Percent Splice Strand
CG14292-RA 1..507 49..555 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:16:32 Download gff for LP20351.complete
Subject Subject Range Query Range Percent Splice Strand
CG14292-RA 1..507 49..555 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:27:51 Download gff for LP20351.complete
Subject Subject Range Query Range Percent Splice Strand
CG14292-RA 1..507 49..555 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-10 15:42:24 Download gff for LP20351.complete
Subject Subject Range Query Range Percent Splice Strand
CG14292-RA 2..648 1..647 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:34:30 Download gff for LP20351.complete
Subject Subject Range Query Range Percent Splice Strand
CG14292-RA 2..648 1..647 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:16:32 Download gff for LP20351.complete
Subject Subject Range Query Range Percent Splice Strand
CG14292-RA 2..648 1..647 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:27:51 Download gff for LP20351.complete
Subject Subject Range Query Range Percent Splice Strand
CG14292-RA 2..648 1..647 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:13:19 Download gff for LP20351.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18904933..18905477 103..647 100 <- Minus
3R 18905553..18905654 1..102 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:13:19 Download gff for LP20351.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18904933..18905477 103..647 100 <- Minus
3R 18905553..18905654 1..102 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:13:19 Download gff for LP20351.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18904933..18905477 103..647 100 <- Minus
3R 18905553..18905654 1..102 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:16:32 Download gff for LP20351.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14730655..14731199 103..647 100 <- Minus
arm_3R 14731275..14731376 1..102 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:07:52 Download gff for LP20351.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18645764..18646308 103..647 100 <- Minus
3R 18646384..18646485 1..102 100   Minus

LP20351.pep Sequence

Translation from 0 to 554

> LP20351.pep
RNPTTENQVNSDKLKEMKFAIVLLAASIACISAQGPGATVGNPLAGNPFA
AANPYAAAFNPFLNGIFGGAGTGAAAGVAAPVAPSAPFGGASISSFFQSI
VLQREAERLLSQPDFPADLAERVLDVVATSEESISGCNNATLPWLQIRCV
KPLLTTAKNQLKAIDDEWQARLAATASPTGAAAA*

LP20351.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23013-PA 163 GF23013-PA 1..151 17..172 442 78.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16294-PA 168 GG16294-PA 1..156 17..172 586 94.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17390-PA 157 GH17390-PA 1..151 17..175 383 57.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG14292-PA 168 CG14292-PA 1..168 17..184 846 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 10:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24624-PA 169 GI24624-PA 1..154 17..172 477 65.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24111-PA 167 GL24111-PA 1..154 17..171 466 76.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12884-PA 169 GA12884-PA 1..156 17..171 467 75.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18675-PA 168 GM18675-PA 1..168 17..184 639 95.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20146-PA 168 GD20146-PA 1..168 17..184 813 96.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 10:59:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14186-PA 166 GJ14186-PA 1..150 17..171 372 60.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:59:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22438-PA 161 GK22438-PA 1..157 17..177 427 59.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:59:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25164-PA 168 GE25164-PA 1..156 17..172 582 93.6 Plus

LP20351.hyp Sequence

Translation from 0 to 554

> LP20351.hyp
RNPTTENQVNSDKLKEMKFAIVLLAASIACISAQGPGATVGNPLAGNPFA
AANPYAAAFNPFLNGIFGGAGTGAAAGVAAPVAPSAPFGGASISSFFQSI
VLQREAERLLSQPDFPADLAERVLDVVATSEESISGCNNATLPWLQIRCV
KPLLTTAKNQLKAIDDEWQARLAATASPTGAAAA*

LP20351.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:21:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG14292-PA 168 CG14292-PA 1..168 17..184 846 100 Plus