Clone LP20380 Report

Search the DGRC for LP20380

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:203
Well:80
Vector:pOT2
Associated Gene/TranscriptCG8680-RA
Protein status:LP20380.pep: gold
Sequenced Size:580

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8680 2003-01-01 Sim4 clustering to Release 3
CG8680 2004-01-31 Blastp of sequenced clone
CG8680 2008-04-29 Release 5.5 accounting
CG8680 2008-08-15 Release 5.9 accounting
CG8680 2008-12-18 5.12 accounting

Clone Sequence Records

LP20380.complete Sequence

580 bp (580 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011535

> LP20380.complete
ACGCTGTCAGCCTGACAGTTACAGGGTGTTTCGTGTCAGAATACATTTTG
CGTACAAATTTTTGTGGTAAAAAATGGCCAGCAAGCAATTGGTAAACAAT
TTGTCCAAACTCGGCCTTCCGCGACAGAATTGGATGTCCCCACTGGCCAG
CGTTCGCCACTCCAGCTGCCGCGGCGACATCGAGAAGGTTACACACACCG
GACAAGTGTTCGATAAGGAGGACTACCGCAATGCCCGGTTCGTGAACGCC
AAGCGGTATGTGAACGAGAACTGGGGCATCAAGCTCATCGAGGAGGTGCC
ACCCAAGGAGTGCACCGAACGAGTTGTCTTCTGCGACGGCGGCGATGGTC
CTTTGGGTCATCCCAAAGTGTACATCAACCTGGACAAACCCGGAAATCAC
ATCTGCGGCTACTGCGGCCTGCGCTTCGTCAAGAAAGATGACCATCATCA
TTGAGGAAACCATAGTGGCCAATAGATTTTAGCTAAAACACCTTTCTATC
CTGTTGCGCTAGCTTGAACTAAACTAAACTAAATAAAATTAGAACACCAA
AAAGCTAAAAAAAAAAAAAAAAAAAAAAAA

LP20380.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG8680-RA 778 CG8680-RA 94..651 1..558 2790 100 Plus
CG8680.a 561 CG8680.a 1..383 1..383 1915 100 Plus
CG8680.a 561 CG8680.a 387..561 382..556 875 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:15:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5099108..5099314 207..1 1035 100 Minus
chr2L 23010047 chr2L 5098836..5099013 383..206 890 100 Minus
chr2L 23010047 chr2L 5098600..5098774 556..382 875 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:58:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5100008..5100214 207..1 1035 100 Minus
2L 23513712 2L 5099736..5099913 383..206 890 100 Minus
2L 23513712 2L 5099498..5099674 558..382 885 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5100008..5100214 207..1 1035 100 Minus
2L 23513712 2L 5099736..5099913 383..206 890 100 Minus
2L 23513712 2L 5099498..5099674 558..382 885 100 Minus
Blast to na_te.dros performed on 2019-03-16 22:15:11 has no hits.

LP20380.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:16:02 Download gff for LP20380.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5098600..5098773 383..556 100 <- Minus
chr2L 5098837..5099013 206..382 100 <- Minus
chr2L 5099110..5099314 1..205 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:43:57 Download gff for LP20380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8680-RA 1..381 74..454 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:57:49 Download gff for LP20380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8680-RA 1..381 74..454 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:13:25 Download gff for LP20380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8680-RA 1..381 74..454 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:38:37 Download gff for LP20380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8680-RA 1..381 74..454 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:37:59 Download gff for LP20380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8680-RA 1..381 74..454 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:37:30 Download gff for LP20380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8680-RA 1..556 1..556 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:57:49 Download gff for LP20380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8680-RA 1..556 1..556 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:13:25 Download gff for LP20380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8680-RA 1..544 13..556 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:38:38 Download gff for LP20380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8680-RA 1..520 37..556 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:37:59 Download gff for LP20380.complete
Subject Subject Range Query Range Percent Splice Strand
CG8680-RC 75..630 1..556 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:16:02 Download gff for LP20380.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5099737..5099913 206..382 100 <- Minus
2L 5100010..5100214 1..205 100   Minus
2L 5099500..5099673 383..556 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:16:02 Download gff for LP20380.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5099737..5099913 206..382 100 <- Minus
2L 5100010..5100214 1..205 100   Minus
2L 5099500..5099673 383..556 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:16:02 Download gff for LP20380.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5099737..5099913 206..382 100 <- Minus
2L 5100010..5100214 1..205 100   Minus
2L 5099500..5099673 383..556 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:13:25 Download gff for LP20380.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5099500..5099673 383..556 100 <- Minus
arm_2L 5099737..5099913 206..382 100 <- Minus
arm_2L 5100010..5100214 1..205 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:17:15 Download gff for LP20380.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5099500..5099673 383..556 100 <- Minus
2L 5099737..5099913 206..382 100 <- Minus
2L 5100010..5100214 1..205 100   Minus

LP20380.hyp Sequence

Translation from 73 to 453

> LP20380.hyp
MASKQLVNNLSKLGLPRQNWMSPLASVRHSSCRGDIEKVTHTGQVFDKED
YRNARFVNAKRYVNENWGIKLIEEVPPKECTERVVFCDGGDGPLGHPKVY
INLDKPGNHICGYCGLRFVKKDDHHH*

LP20380.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG8680-PC 126 CG8680-PC 1..126 1..126 702 100 Plus
CG8680-PB 126 CG8680-PB 1..126 1..126 702 100 Plus
CG8680-PA 126 CG8680-PA 1..126 1..126 702 100 Plus

LP20380.pep Sequence

Translation from 73 to 453

> LP20380.pep
MASKQLVNNLSKLGLPRQNWMSPLASVRHSSCRGDIEKVTHTGQVFDKED
YRNARFVNAKRYVNENWGIKLIEEVPPKECTERVVFCDGGDGPLGHPKVY
INLDKPGNHICGYCGLRFVKKDDHHH*

LP20380.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15523-PA 125 GF15523-PA 1..125 1..125 605 88 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24316-PA 126 GG24316-PA 1..126 1..126 669 97.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11154-PA 126 GH11154-PA 1..126 1..126 553 80.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:00
Subject Length Description Subject Range Query Range Score Percent Strand
ND-13A-PC 126 CG8680-PC 1..126 1..126 702 100 Plus
ND-13A-PB 126 CG8680-PB 1..126 1..126 702 100 Plus
ND-13A-PA 126 CG8680-PA 1..126 1..126 702 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17860-PA 124 GI17860-PA 1..124 1..124 526 79 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19319-PA 126 GL19319-PA 1..126 1..126 570 81.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21258-PA 126 GA21258-PA 1..126 1..126 566 81 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18034-PA 126 GM18034-PA 1..126 1..126 673 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22662-PA 126 GD22662-PA 1..126 1..126 675 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17358-PA 125 GJ17358-PA 1..125 1..125 491 77.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24561-PA 126 GK24561-PA 1..126 1..126 561 80.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18696-PA 126 GE18696-PA 1..126 1..126 657 95.2 Plus