BDGP Sequence Production Resources |
Search the DGRC for LP20412
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 204 |
Well: | 12 |
Vector: | pOT2 |
Associated Gene/Transcript | CG34193-RA |
Protein status: | LP20412.pep: gold |
Sequenced Size: | 806 |
Gene | Date | Evidence |
---|---|---|
CG34193 | 2008-04-29 | Release 5.5 accounting |
CG34193 | 2008-08-15 | Release 5.9 accounting |
CG34193 | 2008-12-18 | 5.12 accounting |
806 bp (806 high quality bases) assembled on 2006-08-24
GenBank Submission: BT028800
> LP20412.complete CTTGCCTTGAAAACCATATCCTTTGCAACTAACCACACAATGAAAGTACT CCTGGCTTTAACTTTCCTGGCCACTTTGGCTCTTTCAGTGGCCCTTCCCC AGGTGGGACATGGATCTGTAAATGGACCCAGTGGGCGCTTCCCTATGACG AAGAATTGGGCGCAACCTCCGGTTGATTTGCGAAAACCCATTATCTTTCT GCCAGAGGCCACGCCCATTCACGAAGCCCAGGAGTCGCGCCCCCGACTAG CCAAACATCGCAAGAGTGGATAGATGCCAAGGAATACCTATTTATTATTT AAATTTAATAAGTATATGTTCGTAAGACAATCTGTTTCGTTGACATCTTA TAGATGCGAATTATATTTAGCAAAACATTAGAAAAGTCAAGGAATTTCTG AAATATAAGTTAAGAAACATAGCACTAACTCGCTATAAAATAGCTTACAT TCTAATAACTAAATTTGGCCTTCATTCGAATTAATTGAACATGAAGTTCA CAAAAATTAGGTACAAAAACATTAATTTACTTTGGAGAAGGACGAAACAT AATTTAATCTTGCTTACAAATTTACAAAATGCAACCAGTTTTTTTCGCGT GCTATATTTTATTGAGTTTTTGATAAATTTCGCTAATCAAACATTACAAC ATATATATATGGCGTGCTTAATGGCACTAACTAATGCTTAACTAATAACT TATTTAATTTAAAACATTAATTTCTGTGCCAGATATAAAACAAGTAAGGC AATGCAAATAAATTGTTTGATTGTAGCTGAAGAACTTTAAAAAAAAAAAA AAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
HeT-A | 6083 | HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). | 326..489 | 372..535 | 117 | 54.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 13397014..13397148 | 1..135 | 98 | -> | Plus |
chr2R | 13397216..13397868 | 136..788 | 96 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34193-RA | 1..234 | 40..273 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34193-RA | 1..234 | 40..273 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34193-RA | 1..234 | 40..273 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34193-RA | 1..234 | 40..273 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34193-RA | 1..234 | 40..273 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34193-RA | 1..725 | 7..731 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34193-RA | 1..725 | 7..731 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34193-RA | 1..788 | 1..788 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34193-RA | 1..725 | 7..731 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34193-RA | 19..806 | 1..788 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17509944..17510078 | 1..135 | 100 | -> | Plus |
2R | 17510146..17510798 | 136..788 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17509944..17510078 | 1..135 | 100 | -> | Plus |
2R | 17510146..17510798 | 136..788 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17509944..17510078 | 1..135 | 100 | -> | Plus |
2R | 17510146..17510798 | 136..788 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 13397449..13397583 | 1..135 | 100 | -> | Plus |
arm_2R | 13397651..13398303 | 136..788 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17511143..17511277 | 1..135 | 100 | -> | Plus |
2R | 17511345..17511997 | 136..788 | 100 | Plus |
Translation from 0 to 272
> LP20412.hyp LALKTISFATNHTMKVLLALTFLATLALSVALPQVGHGSVNGPSGRFPMT KNWAQPPVDLRKPIIFLPEATPIHEAQESRPRLAKHRKSG*
Translation from 0 to 272
> LP20412.pep LALKTISFATNHTMKVLLALTFLATLALSVALPQVGHGSVNGPSGRFPMT KNWAQPPVDLRKPIIFLPEATPIHEAQESRPRLAKHRKSG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13131-PA | 73 | GF13131-PA | 1..72 | 18..89 | 296 | 76.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20690-PA | 77 | GG20690-PA | 1..77 | 14..90 | 291 | 89.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34193-PB | 77 | CG34193-PB | 1..77 | 14..90 | 398 | 100 | Plus |
CG34193-PA | 77 | CG34193-PA | 1..77 | 14..90 | 398 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18586-PA | 79 | GI18586-PA | 1..74 | 14..82 | 175 | 56.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11433-PA | 78 | GL11433-PA | 1..76 | 14..88 | 236 | 72.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24727-PA | 78 | GA24727-PA | 1..76 | 14..88 | 236 | 72.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21789-PA | 77 | GM21789-PA | 1..77 | 14..90 | 333 | 94.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11279-PA | 77 | GD11279-PA | 1..77 | 14..90 | 387 | 96.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20384-PA | 75 | GJ20384-PA | 1..75 | 14..90 | 201 | 53.2 | Plus |
Dvir\GJ20383-PA | 347 | GJ20383-PA | 302..344 | 44..86 | 139 | 60.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22907-PA | 74 | GK22907-PA | 10..73 | 20..85 | 209 | 59.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11674-PA | 77 | GE11674-PA | 1..77 | 14..90 | 381 | 94.8 | Plus |