Clone LP21121 Report

Search the DGRC for LP21121

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:211
Well:21
Vector:pOT2
Associated Gene/TranscriptCG15098-RA
Protein status:LP21121.pep: gold
Sequenced Size:1065

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15098 2003-01-01 Sim4 clustering to Release 3
CG15098 2008-04-29 Release 5.5 accounting
CG15098 2008-08-15 Release 5.9 accounting
CG15098 2008-12-18 5.12 accounting

Clone Sequence Records

LP21121.complete Sequence

1065 bp (1065 high quality bases) assembled on 2005-06-20

GenBank Submission: BT023497

> LP21121.complete
CCAATTGCGACTTATCAAGCAATTGCAATTTTGCTGCGCCGGCGAACTGA
AGTAAAATTGTCTTTATCTTCGCATTAGCACGAAATCAAGTGAATCCAGA
ATGCTGTCCAGGGTCTTCTGTATGCGCCTGAACACCTATGGTGTGGTCAT
TGGATGGCTGGGCGTGATTCTATCCTTCTTGGCCACGATCCTCTTGTCCT
TGGCCCTCGGATTCGTCGATGAAATTGCGCAGCAGATCGCCAAGGGATCG
GAAGATTCTAACAAGACGGCCACCGAGATTCGCAGTGTGCTAATCATCGT
TTTCAGTGTTTACCTGGCGCTCAAGGTGATTAATCTTCTGGCTTCGGCCA
TGTTGGTTGCAGGTACCGTTAAGGAACGCCATTTACTCCTGCTGCCCTGG
CTGATCAACAATGGAGTGCTGCTTGTCTTTGGAATTATCACCAATATTGC
AATGCTGGCCCAGATCATCGGAAATACATCTTTCCTGAGCGCTCTTCCAA
TCATTTTCGTGGATGTTGGCCTGCTCTTGCTGACCTGGTATCTCTACTAC
GGCATCTACTCGCTCTTCAAGCAGATCCAGGCATCCCGTGAGATCCAGCG
CCCGCTGATCCCACAGCCGACCCAGCAGACCAACTCCTATCCCAGCTACA
CCAAGATTTAAGCTCCAGTGTAGCTTCCCGTTTGGCCAGCTCTTATTTCA
TCATATCCCTTTTCGAATGTTTCCAATGGGGCTTCCCCGATAAACCCAAT
ATTTTTCTAGCTAGTAGCACCAAAATTATATACTACGTTGTATTTCATGC
ATCAGAGAATGAAAATCTGTGTGTACATCATATATATTTACATTAACGCG
ATTGTGTCTATACGTATATCCAAACGAAATGGCCAATACAAGATTTTTCG
ATTGGCTGCAAAAAAAAAAATATATATTTTTTATATAAATAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAA

LP21121.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG15098-RA 1102 CG15098-RA 108..1049 1..942 4710 100 Plus
CG15098.a 948 CG15098.a 10..948 1..942 4640 99.6 Plus
CG15098.b 1053 CG15098.b 398..1053 287..942 3280 100 Plus
CG15098.b 1053 CG15098.b 33..319 1..287 1435 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:15:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14720494..14720907 940..528 1830 97.1 Minus
chr2R 21145070 chr2R 14721599..14721885 287..1 1435 100 Minus
chr2R 21145070 chr2R 14721088..14721243 527..372 765 99.4 Minus
chr2R 21145070 chr2R 14721433..14721520 374..287 440 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:58:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18833370..18833784 942..528 2075 100 Minus
2R 25286936 2R 18834476..18834762 287..1 1435 100 Minus
2R 25286936 2R 18833965..18834120 527..372 780 100 Minus
2R 25286936 2R 18834310..18834397 374..287 440 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18834569..18834983 942..528 2075 100 Minus
2R 25260384 2R 18835675..18835961 287..1 1435 100 Minus
2R 25260384 2R 18835164..18835319 527..372 780 100 Minus
2R 25260384 2R 18835509..18835596 374..287 440 100 Minus
Blast to na_te.dros performed on 2019-03-16 22:15:16 has no hits.

LP21121.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:16:04 Download gff for LP21121.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14720525..14720907 528..907 97 <- Minus
chr2R 14721088..14721241 374..527 99 <- Minus
chr2R 14721434..14721519 288..373 100 <- Minus
chr2R 14721599..14721885 1..287 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:44:11 Download gff for LP21121.complete
Subject Subject Range Query Range Percent Splice Strand
CG15098-RA 1..561 101..661 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:57:22 Download gff for LP21121.complete
Subject Subject Range Query Range Percent Splice Strand
CG15098-RA 1..561 101..661 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:13:29 Download gff for LP21121.complete
Subject Subject Range Query Range Percent Splice Strand
CG15098-RA 1..561 101..661 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:38:13 Download gff for LP21121.complete
Subject Subject Range Query Range Percent Splice Strand
CG15098-RA 1..561 101..661 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:38:03 Download gff for LP21121.complete
Subject Subject Range Query Range Percent Splice Strand
CG15098-RA 1..561 101..661 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:36:43 Download gff for LP21121.complete
Subject Subject Range Query Range Percent Splice Strand
CG15098-RA 10..949 1..940 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:57:22 Download gff for LP21121.complete
Subject Subject Range Query Range Percent Splice Strand
CG15098-RA 10..949 1..940 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:13:29 Download gff for LP21121.complete
Subject Subject Range Query Range Percent Splice Strand
CG15098-RA 14..953 1..940 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:38:14 Download gff for LP21121.complete
Subject Subject Range Query Range Percent Splice Strand
CG15098-RA 1..786 8..793 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:38:03 Download gff for LP21121.complete
Subject Subject Range Query Range Percent Splice Strand
CG15098-RA 14..953 1..940 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:16:04 Download gff for LP21121.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18833372..18833784 528..940 100 <- Minus
2R 18833965..18834118 374..527 100 <- Minus
2R 18834311..18834396 288..373 100 <- Minus
2R 18834476..18834762 1..287 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:16:04 Download gff for LP21121.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18833372..18833784 528..940 100 <- Minus
2R 18833965..18834118 374..527 100 <- Minus
2R 18834311..18834396 288..373 100 <- Minus
2R 18834476..18834762 1..287 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:16:04 Download gff for LP21121.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18833372..18833784 528..940 100 <- Minus
2R 18833965..18834118 374..527 100 <- Minus
2R 18834311..18834396 288..373 100 <- Minus
2R 18834476..18834762 1..287 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:13:29 Download gff for LP21121.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14720877..14721289 528..940 100 <- Minus
arm_2R 14721470..14721623 374..527 100 <- Minus
arm_2R 14721816..14721901 288..373 100 <- Minus
arm_2R 14721981..14722267 1..287 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:16:46 Download gff for LP21121.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18834571..18834983 528..940 100 <- Minus
2R 18835164..18835317 374..527 100 <- Minus
2R 18835510..18835595 288..373 100 <- Minus
2R 18835675..18835961 1..287 100   Minus

LP21121.pep Sequence

Translation from 100 to 660

> LP21121.pep
MLSRVFCMRLNTYGVVIGWLGVILSFLATILLSLALGFVDEIAQQIAKGS
EDSNKTATEIRSVLIIVFSVYLALKVINLLASAMLVAGTVKERHLLLLPW
LINNGVLLVFGIITNIAMLAQIIGNTSFLSALPIIFVDVGLLLLTWYLYY
GIYSLFKQIQASREIQRPLIPQPTQQTNSYPSYTKI*

LP21121.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13748-PA 189 GF13748-PA 1..189 1..186 585 63.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:43:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20940-PA 186 GG20940-PA 1..186 1..186 762 80.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:43:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19735-PA 188 GH19735-PA 1..188 1..186 451 51.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG15098-PA 186 CG15098-PA 1..186 1..186 917 100 Plus
CG13747-PA 222 CG13747-PA 24..183 2..160 156 26.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:43:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20159-PA 192 GI20159-PA 1..192 1..186 404 51.8 Plus
Dmoj\GI20158-PA 189 GI20158-PA 1..188 1..185 378 46.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:43:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10847-PA 191 GL10847-PA 1..191 1..186 593 60.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:43:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24507-PA 191 GA24507-PA 1..191 1..186 593 60.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:43:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19868-PA 187 GM19868-PA 1..187 1..186 844 87.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:43:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25356-PA 187 GD25356-PA 1..187 1..186 860 89.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:43:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21998-PA 191 GJ21998-PA 1..191 1..186 440 51.8 Plus
Dvir\GJ21178-PA 217 GJ21178-PA 28..190 7..166 139 30.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:43:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20699-PA 187 GK20699-PA 1..186 1..185 432 47.8 Plus
Dwil\GK20690-PA 166 GK20690-PA 1..158 1..163 224 34.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13878-PA 186 GE13878-PA 1..186 1..186 846 88.7 Plus

LP21121.hyp Sequence

Translation from 100 to 660

> LP21121.hyp
MLSRVFCMRLNTYGVVIGWLGVILSFLATILLSLALGFVDEIAQQIAKGS
EDSNKTATEIRSVLIIVFSVYLALKVINLLASAMLVAGTVKERHLLLLPW
LINNGVLLVFGIITNIAMLAQIIGNTSFLSALPIIFVDVGLLLLTWYLYY
GIYSLFKQIQASREIQRPLIPQPTQQTNSYPSYTKI*

LP21121.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG15098-PA 186 CG15098-PA 1..186 1..186 917 100 Plus
CG13747-PA 222 CG13747-PA 24..183 2..160 156 26.4 Plus