Clone LP21183 Report

Search the DGRC for LP21183

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:211
Well:83
Vector:pOT2
Associated Gene/TranscriptCG13067-RA
Protein status:LP21183.pep: gold
Sequenced Size:563

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13067 2003-01-01 Sim4 clustering to Release 3
CG13067 2008-04-29 Release 5.5 accounting
CG13067 2008-08-15 Release 5.9 accounting
CG13067 2008-12-18 5.12 accounting

Clone Sequence Records

LP21183.complete Sequence

563 bp (563 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011536

> LP21183.complete
TGAGAACCAACAGTTCACAACCAACCCAAACAGCCAACATGTTCAAATAC
TTCGCTCTGTGCCTGTTCGCCATCGTGGCCTGCGTCTCTGCCAAGCCGGC
GGTGCTCGCTTCTCCTCTGGCCTACAGCGCCTACTCCGCTCCCTATGTGG
CAGCTGCTCCTTACTCGGCTGCCTACACCGCGGCATACACCGCTCCAGTG
GCCGCCGCCTACTCCGCCTACACGTACCCCTATGCGTCCGCCTACTCCGC
CTACCCCTATGCCGCCTACTACCGTTAAGACTGGATGAATGGATCGTGAT
CTTAACCTGACTGCTGAACTGGACCTGAATATAAACATATACACATCTAT
TGCAACAAGGATACACACCTTCCTGCTAACCACCTGCAACATCCAATCTT
CTTACATCCCTGGTGTTAGTTCGACAGACTCTACATTTCCCCACCTCTGC
CGACTGCTGAAAGTTAAGTCATGGGAACAGGACATACCACTTCAAGAAAG
GGAATATTTTTGTTGAAATAAATACTGCATTTTGCGTAAAACGTAAAAAA
AAAAAAAAAAAAA

LP21183.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG13067-RA 719 CG13067-RA 124..668 1..545 2725 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16261125..16261618 51..544 2425 99.4 Plus
chr3L 24539361 chr3L 16261002..16261051 1..50 250 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:58:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:28:15
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16271425..16271919 51..545 2475 100 Plus
3L 28110227 3L 16271302..16271351 1..50 250 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16264525..16265019 51..545 2475 100 Plus
3L 28103327 3L 16264402..16264451 1..50 250 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:28:15 has no hits.

LP21183.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:29:10 Download gff for LP21183.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16261002..16261051 1..50 100 -> Plus
chr3L 16261125..16261618 51..544 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:44:13 Download gff for LP21183.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 1..240 39..278 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:47:54 Download gff for LP21183.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 1..240 39..278 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:20 Download gff for LP21183.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 1..240 39..278 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:29:16 Download gff for LP21183.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 1..240 39..278 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:11:53 Download gff for LP21183.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 1..240 39..278 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:21:09 Download gff for LP21183.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 1..537 8..544 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:47:54 Download gff for LP21183.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 1..544 1..544 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:20 Download gff for LP21183.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 21..564 1..544 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:29:16 Download gff for LP21183.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 1..537 8..544 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:11:53 Download gff for LP21183.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 21..564 1..544 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:29:10 Download gff for LP21183.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16271302..16271351 1..50 100 -> Plus
3L 16271425..16271918 51..544 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:29:10 Download gff for LP21183.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16271302..16271351 1..50 100 -> Plus
3L 16271425..16271918 51..544 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:29:10 Download gff for LP21183.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16271302..16271351 1..50 100 -> Plus
3L 16271425..16271918 51..544 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:20 Download gff for LP21183.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16264402..16264451 1..50 100 -> Plus
arm_3L 16264525..16265018 51..544 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:07:42 Download gff for LP21183.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16264525..16265018 51..544 100   Plus
3L 16264402..16264451 1..50 100 -> Plus

LP21183.hyp Sequence

Translation from 0 to 309

> LP21183.hyp
ENQQFTTNPNSQHVQILRSVPVRHRGLRLCQAGGARFSSGLQRLLRSLCG
SCSLLGCLHRGIHRSSGRRLLRLHVPLCVRLLRLPLCRLLPLRLDEWIVI
LT*
Sequence LP21183.hyp has no blast hits.

LP21183.pep Sequence

Translation from 38 to 277

> LP21183.pep
MFKYFALCLFAIVACVSAKPAVLASPLAYSAYSAPYVAAAPYSAAYTAAY
TAPVAAAYSAYTYPYASAYSAYPYAAYYR*

LP21183.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24171-PA 79 GF24171-PA 1..79 1..79 150 92.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13067-PA 79 CG13067-PA 1..79 1..79 408 100 Plus
CG13051-PA 83 CG13051-PA 1..75 1..77 176 56 Plus
CG13069-PA 97 CG13069-PA 1..76 1..76 175 55 Plus
CG13674-PB 137 CG13674-PB 2..99 3..78 174 47.5 Plus
CG13674-PA 137 CG13674-PA 2..99 3..78 174 47.5 Plus
CG13679-PB 119 CG13679-PB 2..97 3..78 173 47.5 Plus
CG13068-PA 109 CG13068-PA 1..99 1..77 156 54.5 Plus
CG32266-PA 77 CG32266-PA 1..74 1..78 150 50 Plus
CG13678-PA 128 CG13678-PA 1..101 1..78 149 45.1 Plus
CG13066-PB 93 CG13066-PB 1..73 1..75 139 51.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12649-PA 75 GI12649-PA 1..34 1..34 138 79.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25608-PA 79 GM25608-PA 1..79 1..79 328 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14613-PA 79 GD14613-PA 1..79 1..79 328 98.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16554-PA 175 GK16554-PA 100..136 5..41 132 78.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19543-PA 79 GE19543-PA 1..79 1..79 155 93.7 Plus