LP21183.complete Sequence
563 bp (563 high quality bases) assembled on 2004-01-31
GenBank Submission: BT011536
> LP21183.complete
TGAGAACCAACAGTTCACAACCAACCCAAACAGCCAACATGTTCAAATAC
TTCGCTCTGTGCCTGTTCGCCATCGTGGCCTGCGTCTCTGCCAAGCCGGC
GGTGCTCGCTTCTCCTCTGGCCTACAGCGCCTACTCCGCTCCCTATGTGG
CAGCTGCTCCTTACTCGGCTGCCTACACCGCGGCATACACCGCTCCAGTG
GCCGCCGCCTACTCCGCCTACACGTACCCCTATGCGTCCGCCTACTCCGC
CTACCCCTATGCCGCCTACTACCGTTAAGACTGGATGAATGGATCGTGAT
CTTAACCTGACTGCTGAACTGGACCTGAATATAAACATATACACATCTAT
TGCAACAAGGATACACACCTTCCTGCTAACCACCTGCAACATCCAATCTT
CTTACATCCCTGGTGTTAGTTCGACAGACTCTACATTTCCCCACCTCTGC
CGACTGCTGAAAGTTAAGTCATGGGAACAGGACATACCACTTCAAGAAAG
GGAATATTTTTGTTGAAATAAATACTGCATTTTGCGTAAAACGTAAAAAA
AAAAAAAAAAAAA
LP21183.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:26:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13067-RA | 719 | CG13067-RA | 124..668 | 1..545 | 2725 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:28:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 16261125..16261618 | 51..544 | 2425 | 99.4 | Plus |
chr3L | 24539361 | chr3L | 16261002..16261051 | 1..50 | 250 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:58:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:28:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 16271425..16271919 | 51..545 | 2475 | 100 | Plus |
3L | 28110227 | 3L | 16271302..16271351 | 1..50 | 250 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:18:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 16264525..16265019 | 51..545 | 2475 | 100 | Plus |
3L | 28103327 | 3L | 16264402..16264451 | 1..50 | 250 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 02:28:15 has no hits.
LP21183.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:29:10 Download gff for
LP21183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 16261002..16261051 | 1..50 | 100 | -> | Plus |
chr3L | 16261125..16261618 | 51..544 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:44:13 Download gff for
LP21183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13067-RA | 1..240 | 39..278 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:47:54 Download gff for
LP21183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13067-RA | 1..240 | 39..278 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:13:20 Download gff for
LP21183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13067-RA | 1..240 | 39..278 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:29:16 Download gff for
LP21183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13067-RA | 1..240 | 39..278 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:11:53 Download gff for
LP21183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13067-RA | 1..240 | 39..278 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:21:09 Download gff for
LP21183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13067-RA | 1..537 | 8..544 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:47:54 Download gff for
LP21183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13067-RA | 1..544 | 1..544 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:13:20 Download gff for
LP21183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13067-RA | 21..564 | 1..544 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:29:16 Download gff for
LP21183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13067-RA | 1..537 | 8..544 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:11:53 Download gff for
LP21183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13067-RA | 21..564 | 1..544 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:29:10 Download gff for
LP21183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16271302..16271351 | 1..50 | 100 | -> | Plus |
3L | 16271425..16271918 | 51..544 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:29:10 Download gff for
LP21183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16271302..16271351 | 1..50 | 100 | -> | Plus |
3L | 16271425..16271918 | 51..544 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:29:10 Download gff for
LP21183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16271302..16271351 | 1..50 | 100 | -> | Plus |
3L | 16271425..16271918 | 51..544 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:13:20 Download gff for
LP21183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 16264402..16264451 | 1..50 | 100 | -> | Plus |
arm_3L | 16264525..16265018 | 51..544 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:07:42 Download gff for
LP21183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16264525..16265018 | 51..544 | 100 | | Plus |
3L | 16264402..16264451 | 1..50 | 100 | -> | Plus |
LP21183.hyp Sequence
Translation from 0 to 309
> LP21183.hyp
ENQQFTTNPNSQHVQILRSVPVRHRGLRLCQAGGARFSSGLQRLLRSLCG
SCSLLGCLHRGIHRSSGRRLLRLHVPLCVRLLRLPLCRLLPLRLDEWIVI
LT*
Sequence LP21183.hyp has no blast hits.
LP21183.pep Sequence
Translation from 38 to 277
> LP21183.pep
MFKYFALCLFAIVACVSAKPAVLASPLAYSAYSAPYVAAAPYSAAYTAAY
TAPVAAAYSAYTYPYASAYSAYPYAAYYR*
LP21183.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:46:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF24171-PA | 79 | GF24171-PA | 1..79 | 1..79 | 150 | 92.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13067-PA | 79 | CG13067-PA | 1..79 | 1..79 | 408 | 100 | Plus |
CG13051-PA | 83 | CG13051-PA | 1..75 | 1..77 | 176 | 56 | Plus |
CG13069-PA | 97 | CG13069-PA | 1..76 | 1..76 | 175 | 55 | Plus |
CG13674-PB | 137 | CG13674-PB | 2..99 | 3..78 | 174 | 47.5 | Plus |
CG13674-PA | 137 | CG13674-PA | 2..99 | 3..78 | 174 | 47.5 | Plus |
CG13679-PB | 119 | CG13679-PB | 2..97 | 3..78 | 173 | 47.5 | Plus |
CG13068-PA | 109 | CG13068-PA | 1..99 | 1..77 | 156 | 54.5 | Plus |
CG32266-PA | 77 | CG32266-PA | 1..74 | 1..78 | 150 | 50 | Plus |
CG13678-PA | 128 | CG13678-PA | 1..101 | 1..78 | 149 | 45.1 | Plus |
CG13066-PB | 93 | CG13066-PB | 1..73 | 1..75 | 139 | 51.2 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:46:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI12649-PA | 75 | GI12649-PA | 1..34 | 1..34 | 138 | 79.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:46:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25608-PA | 79 | GM25608-PA | 1..79 | 1..79 | 328 | 98.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:46:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14613-PA | 79 | GD14613-PA | 1..79 | 1..79 | 328 | 98.7 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:46:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK16554-PA | 175 | GK16554-PA | 100..136 | 5..41 | 132 | 78.4 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:46:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE19543-PA | 79 | GE19543-PA | 1..79 | 1..79 | 155 | 93.7 | Plus |