Clone LP21185 Report

Search the DGRC for LP21185

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:211
Well:85
Vector:pOT2
Associated Gene/TranscriptCG4858-RA
Protein status:LP21185.pep: gold
Sequenced Size:947

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4858 2003-01-01 Sim4 clustering to Release 3
CG4858 2004-03-05 Blastp of sequenced clone
CG4858 2008-04-29 Release 5.5 accounting
CG4858 2008-08-15 Release 5.9 accounting
CG4858 2008-12-18 5.12 accounting

Clone Sequence Records

LP21185.complete Sequence

947 bp (947 high quality bases) assembled on 2004-03-05

GenBank Submission: BT012307

> LP21185.complete
ACGCAATCCACGACTTTGCATTGGTTTCGGAATAAATTGCTTTTAAATCG
CTTTATAATGCTGGACAAGGTTAAAAATGTTATCGTAGTGCTATCAGGCA
AGGGCGGAGTAGGAAAATCCACAGTGAGCACCCAATTATCGCTGGCACTG
CGAAAAAACGGATTTAAGGTTGGTCTGCTCGATATAGATCTGTGTGGACC
GAGTGTGCCATATCTATTGGGTCTGGAAGGACGGGATATCTTCCAGTGCG
ACGATGGATGGGTTCCTGTCTATACAGATGAATCCCAAACCTTGGCGGTG
ATGTCCATTGGATTTTTATTGAAGAACCGTGAGGATCCGGTCATTTGGCG
TGGTCCCAAAAAGACCATGATGATCCGGCAGTTCCTCACCGACGTCAGGT
GGGATGAGCTGGATTACCTAATTATCGATACGCCACCCGGCACTTCGGAT
GAGCACATCACCGTAATGGAGTGCCTGAAGGAGGTTGGTTGCCACGGAGC
CATAATTGTGACCACACCGCAGGAGGTGGCCCTGGACGATGTACGCAAGG
AGATCACCTTCTGCAAGAAGACCGGCATCAATATCCTGGGCATCGTCGAG
AATATGAGTGGGTTCGTGTGCCCCCATTGCACCTCGTGCACCAATATATT
CTCGTCAAACGGTGGCGTCTCACTGGCCACTTACGCCCAAGTACCACATC
TAGGAACTCTGCCCATAGATCCCCGTGTTGGCATTTTGGCGGGCACCACT
ACGTCCGTCTTGGATGAGCTTCCGGATTCCACGACAGCGGAGGTGCTGAC
GCATATAGTTGAGAAGTTGAAAACGATGTTGGTCTCCTAAATAAATACCA
ACATAACAATTTTGTAAATATGATAGCTTGTTTCATTATTCAGTTTATGA
ATATAACCATTTTCTTCAGGAAACGATTTAAAAAAAAAAAAAAAAAA

LP21185.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:03:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG4858-RA 1136 CG4858-RA 165..1095 1..931 4655 100 Plus
CG4858.a 925 CG4858.a 1..925 1..929 4560 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20515826..20516272 167..613 2235 100 Plus
chr3L 24539361 chr3L 20516582..20516900 611..929 1595 100 Plus
chr3L 24539361 chr3L 20515587..20515756 1..170 850 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:58:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20526836..20527282 167..613 2235 100 Plus
3L 28110227 3L 20527592..20527912 611..931 1605 100 Plus
3L 28110227 3L 20526597..20526766 1..170 850 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20519936..20520382 167..613 2235 100 Plus
3L 28103327 3L 20520692..20521012 611..931 1605 100 Plus
3L 28103327 3L 20519697..20519866 1..170 850 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:27:27 has no hits.

LP21185.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:28:19 Download gff for LP21185.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20515587..20515754 1..168 100 -> Plus
chr3L 20515828..20516270 169..611 100 -> Plus
chr3L 20516583..20516900 612..929 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:44:15 Download gff for LP21185.complete
Subject Subject Range Query Range Percent Splice Strand
CG4858-RA 1..783 58..840 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:39:15 Download gff for LP21185.complete
Subject Subject Range Query Range Percent Splice Strand
CG4858-RA 1..783 58..840 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:25:41 Download gff for LP21185.complete
Subject Subject Range Query Range Percent Splice Strand
CG4858-RA 1..783 58..840 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:22:59 Download gff for LP21185.complete
Subject Subject Range Query Range Percent Splice Strand
CG4858-RA 1..783 58..840 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:46:06 Download gff for LP21185.complete
Subject Subject Range Query Range Percent Splice Strand
CG4858-RA 1..783 58..840 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:47:31 Download gff for LP21185.complete
Subject Subject Range Query Range Percent Splice Strand
CG4858-RA 1..783 58..840 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:39:14 Download gff for LP21185.complete
Subject Subject Range Query Range Percent Splice Strand
CG4858-RA 1..929 1..929 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:25:41 Download gff for LP21185.complete
Subject Subject Range Query Range Percent Splice Strand
CG4858-RA 22..950 1..929 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:22:59 Download gff for LP21185.complete
Subject Subject Range Query Range Percent Splice Strand
CG4858-RA 1..783 58..840 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:46:06 Download gff for LP21185.complete
Subject Subject Range Query Range Percent Splice Strand
CG4858-RA 22..950 1..929 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:19 Download gff for LP21185.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20526597..20526764 1..168 100 -> Plus
3L 20526838..20527280 169..611 100 -> Plus
3L 20527593..20527910 612..929 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:19 Download gff for LP21185.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20526597..20526764 1..168 100 -> Plus
3L 20526838..20527280 169..611 100 -> Plus
3L 20527593..20527910 612..929 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:19 Download gff for LP21185.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20526597..20526764 1..168 100 -> Plus
3L 20526838..20527280 169..611 100 -> Plus
3L 20527593..20527910 612..929 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:25:41 Download gff for LP21185.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20519697..20519864 1..168 100 -> Plus
arm_3L 20519938..20520380 169..611 100 -> Plus
arm_3L 20520693..20521010 612..929 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:00:26 Download gff for LP21185.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20519938..20520380 169..611 100 -> Plus
3L 20520693..20521010 612..929 100   Plus
3L 20519697..20519864 1..168 100 -> Plus

LP21185.hyp Sequence

Translation from 0 to 839

> LP21185.hyp
TQSTTLHWFRNKLLLNRFIMLDKVKNVIVVLSGKGGVGKSTVSTQLSLAL
RKNGFKVGLLDIDLCGPSVPYLLGLEGRDIFQCDDGWVPVYTDESQTLAV
MSIGFLLKNREDPVIWRGPKKTMMIRQFLTDVRWDELDYLIIDTPPGTSD
EHITVMECLKEVGCHGAIIVTTPQEVALDDVRKEITFCKKTGINILGIVE
NMSGFVCPHCTSCTNIFSSNGGVSLATYAQVPHLGTLPIDPRVGILAGTT
TSVLDELPDSTTAEVLTHIVEKLKTMLVS*

LP21185.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG4858-PA 260 CG4858-PA 1..260 20..279 1355 100 Plus
CG17904-PA 311 CG17904-PA 54..306 24..273 556 47.9 Plus
CG3262-PE 293 CG3262-PE 38..279 24..277 361 34.3 Plus
CG3262-PD 293 CG3262-PD 38..279 24..277 361 34.3 Plus
CG3262-PF 207 CG3262-PF 19..193 94..277 224 31 Plus

LP21185.pep Sequence

Translation from 57 to 839

> LP21185.pep
MLDKVKNVIVVLSGKGGVGKSTVSTQLSLALRKNGFKVGLLDIDLCGPSV
PYLLGLEGRDIFQCDDGWVPVYTDESQTLAVMSIGFLLKNREDPVIWRGP
KKTMMIRQFLTDVRWDELDYLIIDTPPGTSDEHITVMECLKEVGCHGAII
VTTPQEVALDDVRKEITFCKKTGINILGIVENMSGFVCPHCTSCTNIFSS
NGGVSLATYAQVPHLGTLPIDPRVGILAGTTTSVLDELPDSTTAEVLTHI
VEKLKTMLVS*

LP21185.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:35:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10354-PA 261 GF10354-PA 1..260 1..260 1217 88.1 Plus
Dana\GF20875-PA 310 GF20875-PA 50..305 2..254 560 49.2 Plus
Dana\GF22737-PA 310 GF22737-PA 10..195 1..193 327 37.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:35:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16127-PA 260 GG16127-PA 1..260 1..260 1333 96.9 Plus
Dere\GG22765-PA 311 GG22765-PA 51..306 2..254 520 46.9 Plus
Dere\GG21464-PA 294 GG21464-PA 38..279 5..258 345 33.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:35:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14587-PA 264 GH14587-PA 1..257 1..257 1192 86.4 Plus
Dgri\GH11560-PA 311 GH11560-PA 51..279 2..224 563 52.8 Plus
Dgri\GH13628-PA 292 GH13628-PA 34..274 2..251 334 33.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG4858-PA 260 CG4858-PA 1..260 1..260 1355 100 Plus
CG17904-PA 311 CG17904-PA 54..306 5..254 556 47.9 Plus
CG3262-PE 293 CG3262-PE 38..279 5..258 361 34.3 Plus
CG3262-PD 293 CG3262-PD 38..279 5..258 361 34.3 Plus
CG3262-PF 207 CG3262-PF 19..193 75..258 224 31 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:35:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13405-PA 264 GI13405-PA 1..254 1..254 1145 84.3 Plus
Dmoj\GI17051-PA 310 GI17051-PA 51..310 2..258 526 48.9 Plus
Dmoj\GI11769-PA 297 GI11769-PA 34..281 2..258 343 32.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:35:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12799-PA 255 GL12799-PA 1..251 1..254 1115 83.1 Plus
Dper\GL18780-PA 311 GL18780-PA 51..278 2..224 559 52.6 Plus
Dper\GL21144-PA 299 GL21144-PA 44..279 5..251 321 30.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:35:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18483-PA 258 GA18483-PA 1..254 1..254 1156 84.6 Plus
Dpse\GA14715-PA 311 GA14715-PA 51..278 2..224 559 52.6 Plus
Dpse\GA17025-PA 299 GA17025-PA 44..279 5..251 321 30.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:35:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22307-PA 260 GM22307-PA 1..260 1..260 1353 98.8 Plus
Dsec\GM17199-PA 311 GM17199-PA 51..306 2..254 526 47.3 Plus
Dsec\GM18803-PA 293 GM18803-PA 38..279 5..258 340 33.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14899-PA 260 GD14899-PA 1..260 1..260 1342 98.1 Plus
Dsim\GD24076-PA 311 GD24076-PA 51..278 2..224 526 49.6 Plus
Dsim\GD21613-PA 293 GD21613-PA 38..279 5..258 340 33.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11530-PA 266 GJ11530-PA 1..257 1..257 1171 83.7 Plus
Dvir\GJ17301-PA 310 GJ17301-PA 51..278 2..224 554 53.4 Plus
Dvir\GJ13135-PA 298 GJ13135-PA 34..281 2..258 348 32.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:35:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12055-PA 261 GK12055-PA 1..257 1..257 1180 86 Plus
Dwil\GK24826-PA 310 GK24826-PA 50..278 2..225 565 54.1 Plus
Dwil\GK23989-PA 303 GK23989-PA 42..287 2..258 336 31.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23241-PA 260 GE23241-PA 1..260 1..260 1331 96.5 Plus
Dyak\GE19695-PA 260 GE19695-PA 1..260 1..260 1325 96.2 Plus
Dyak\GE12759-PA 311 GE12759-PA 51..306 2..254 529 47.3 Plus
Dyak\GE12953-PA 293 GE12953-PA 38..279 5..258 338 33.1 Plus