Clone LP21536 Report

Search the DGRC for LP21536

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:215
Well:36
Vector:pOT2
Associated Gene/TranscriptCG14963-RA
Protein status:LP21536.pep: gold
Sequenced Size:955

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14963 2003-01-01 Sim4 clustering to Release 3
CG14963 2004-03-24 Blastp of sequenced clone
CG14963 2008-04-29 Release 5.5 accounting
CG14963 2008-08-15 Release 5.9 accounting
CG14963 2008-12-18 5.12 accounting

Clone Sequence Records

LP21536.complete Sequence

955 bp (955 high quality bases) assembled on 2004-03-24

GenBank Submission: BT012308

> LP21536.complete
CAGATATGGCCATCGCTCTGGACTGGCTTCTCCTGATTACCCTGGCCAGT
GGATCCCTGGCACTGTGGTCTCCTCAGTTGGTGCCTCCAACTGTTGGTCT
GTTGGCGCCGGGCCCGCCAGCTACCTTGGCTCCACCACCCACTCTATCCC
AGGATCTGGAAGAAATCCAGCGTCTGATACAGTCGAAGCCATTAAACCAG
CTCTTGGTGCGCTACCTAATCAACGATGCCCAGTTCCAGGCCTTCGTGCG
GATTATCAACAGCAATGCCGCAGTCACTGCCCGCTGGCGTCTGCTCTCGC
AGCCGGAGCTCATTCTCTTTCTGCAGTGGACGGACCAGCAGCTCCTGGCC
TCGGGCGGTTCCTTTGAGTTGGAGGAGCAGAGGCTCAAAGTGAGTCTATT
GAACCAGTTTCCCTACTGGTCCGGCACCGTTTTCGGCTGGCAAGGATTTC
TAAACGAAGTTCAGCTCTACTTTCCACTGTATGCCATCCGAGCCCACATC
GATGCCAAGGTGTTGCAGCAGGGAATTTTCGCCCAGTTCTGGTCGAGATT
ACAGGGGTTGCGAGTCATGTATGAACGTTGGCTGACTACAGTGGAAACTA
CACAGGTTCTGGCTGAACTTCAGAAGGCGGGCATTGATACCGTGCAATTG
GATGGCATCATCCGAGAGCTCCTCGGCTGGAATGCTGTGAATGGTACGGT
AGAAGCCTCCACTGGTGGAACTCCCGCTGCACCTACCGCGATTCCGGGTG
CAGTTTTGCCCCCAGTTAACACTGTTAGTGTGGTTGTCTAGGCTGCCATA
GCACAGTGATGGGGAGTCACCCATTCCTAGGAAGGATTCAACATATAACA
ACTTACCAATTACGTAAGATAAAGCGCACTCGTATGGTAAGAGTTGCACA
ATATTTGTAAAAATAAATTGGGGATCAACTGTTGAAAAAAAAAAAAAAAA
AAAAA

LP21536.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:02:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG14963-RA 933 CG14963-RA 1..933 1..933 4665 100 Plus
CG32278-RA 1004 CG32278-RA 699..1004 933..628 1530 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3171063..3171992 933..1 4495 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:59:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:27:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3171614..3172546 933..1 4665 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:50:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3171614..3172546 933..1 4665 100 Minus
Blast to na_te.dros performed on 2019-03-16 12:27:33 has no hits.

LP21536.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:28:22 Download gff for LP21536.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3171062..3171992 1..934 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:44:18 Download gff for LP21536.complete
Subject Subject Range Query Range Percent Splice Strand
CG14963-RA 1..786 6..791 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:37:26 Download gff for LP21536.complete
Subject Subject Range Query Range Percent Splice Strand
CG14963-RA 1..786 6..791 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:26:18 Download gff for LP21536.complete
Subject Subject Range Query Range Percent Splice Strand
CG14963-RA 1..786 6..791 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:21:14 Download gff for LP21536.complete
Subject Subject Range Query Range Percent Splice Strand
CG14963-RA 1..786 6..791 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:46:11 Download gff for LP21536.complete
Subject Subject Range Query Range Percent Splice Strand
CG14963-RA 1..786 6..791 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:45:05 Download gff for LP21536.complete
Subject Subject Range Query Range Percent Splice Strand
CG14963-RA 1..932 2..933 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:37:26 Download gff for LP21536.complete
Subject Subject Range Query Range Percent Splice Strand
CG14963-RA 1..932 2..933 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:26:18 Download gff for LP21536.complete
Subject Subject Range Query Range Percent Splice Strand
CG14963-RA 1..932 2..933 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:21:14 Download gff for LP21536.complete
Subject Subject Range Query Range Percent Splice Strand
CG14963-RA 1..932 2..933 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:46:11 Download gff for LP21536.complete
Subject Subject Range Query Range Percent Splice Strand
CG14963-RA 1..932 2..933 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:22 Download gff for LP21536.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3171613..3172546 1..934 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:22 Download gff for LP21536.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3171613..3172546 1..934 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:22 Download gff for LP21536.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3171613..3172546 1..934 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:26:18 Download gff for LP21536.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3171613..3172546 1..934 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:58:38 Download gff for LP21536.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3171613..3172546 1..934 99   Minus

LP21536.hyp Sequence

Translation from 2 to 790

> LP21536.hyp
DMAIALDWLLLITLASGSLALWSPQLVPPTVGLLAPGPPATLAPPPTLSQ
DLEEIQRLIQSKPLNQLLVRYLINDAQFQAFVRIINSNAAVTARWRLLSQ
PELILFLQWTDQQLLASGGSFELEEQRLKVSLLNQFPYWSGTVFGWQGFL
NEVQLYFPLYAIRAHIDAKVLQQGIFAQFWSRLQGLRVMYERWLTTVETT
QVLAELQKAGIDTVQLDGIIRELLGWNAVNGTVEASTGGTPAAPTAIPGA
VLPPVNTVSVVV*

LP21536.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14963-PA 261 CG14963-PA 1..261 2..262 1334 100 Plus
CG13905-PB 238 CG13905-PB 21..226 30..229 310 35.9 Plus

LP21536.pep Sequence

Translation from 5 to 790

> LP21536.pep
MAIALDWLLLITLASGSLALWSPQLVPPTVGLLAPGPPATLAPPPTLSQD
LEEIQRLIQSKPLNQLLVRYLINDAQFQAFVRIINSNAAVTARWRLLSQP
ELILFLQWTDQQLLASGGSFELEEQRLKVSLLNQFPYWSGTVFGWQGFLN
EVQLYFPLYAIRAHIDAKVLQQGIFAQFWSRLQGLRVMYERWLTTVETTQ
VLAELQKAGIDTVQLDGIIRELLGWNAVNGTVEASTGGTPAAPTAIPGAV
LPPVNTVSVVV*

LP21536.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10217-PA 260 GF10217-PA 1..260 1..261 921 70.1 Plus
Dana\GF24422-PA 237 GF24422-PA 21..221 31..225 255 34.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14283-PA 263 GG14283-PA 1..251 1..249 1071 89.2 Plus
Dere\GG14747-PA 238 GG14747-PA 4..224 13..226 286 35.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15258-PA 249 GH15258-PA 18..247 22..251 642 52.8 Plus
Dgri\GH16870-PA 230 GH16870-PA 25..214 38..226 326 37.4 Plus
Dgri\GH22503-PA 230 GH22503-PA 25..214 38..226 325 36.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG14963-PA 261 CG14963-PA 1..261 1..261 1334 100 Plus
CG13905-PB 238 CG13905-PB 21..226 29..228 310 35.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11966-PA 244 GI11966-PA 25..238 36..253 662 59.6 Plus
Dmoj\GI11430-PA 241 GI11430-PA 35..228 36..232 361 39.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25249-PA 269 GL25249-PA 1..230 1..229 779 73 Plus
Dper\GL16910-PA 190 GL16910-PA 42..180 46..182 156 36.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13388-PA 269 GA13388-PA 1..230 1..229 780 73 Plus
Dpse\GA12615-PA 241 GA12615-PA 42..232 46..233 197 34.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14077-PA 263 GM14077-PA 1..263 1..261 1195 95.8 Plus
Dsec\GM14365-PA 238 GM14365-PA 17..227 25..229 296 35.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\anon-Payne-PA 263 GD13352-PA 1..263 1..261 1281 97 Plus
Dsim\GD13583-PA 238 GD13583-PA 19..226 27..228 296 36.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12191-PA 253 GJ12191-PA 25..247 23..253 685 58.4 Plus
Dvir\GJ13626-PA 234 GJ13626-PA 40..216 50..225 272 37.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13226-PA 240 GK13226-PA 22..235 44..255 656 65.4 Plus
Dwil\GK17364-PA 236 GK17364-PA 14..221 32..226 304 34.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20712-PA 263 GE20712-PA 1..263 1..261 1092 88.2 Plus
Dyak\GE21109-PA 238 GE21109-PA 21..224 29..226 297 36.3 Plus