Clone LP21834 Report

Search the DGRC for LP21834

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:218
Well:34
Vector:pOT2
Associated Gene/TranscriptCG15386-RA
Protein status:LP21834.pep: gold
Sequenced Size:711

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15386-RA 2009-01-21 est gleaning

Clone Sequence Records

LP21834.complete Sequence

711 bp assembled on 2009-01-21

> LP21834.complete
CGCGGCAGTGGCTGGTTTTATCGATAAGCTGGTAGGTGATTTTGTTTTCC
TTTTTTTTTTGTAAGAAAGCAAACGTGTTTAATATTTACAACTCCCACTT
AAAATGCTGCGCAAAACACCAAAACCTGCAATTTGGAAATTCATCAAAGG
AAGTGCCAAAACACTGTTTGTCCTCGAGGCAGTCTGCTTCGCAGCCAGCT
ACGGCGTTTATTATCGCATGAACACGAATCGAGAGTTTCGTCAGCATATT
CACGAGAACTATCCCTTCGTTTTGGACTATTACTACAAAATTGGTGAAAT
CGTCGGAGACAGCACAGTGCGACAGGCGGATGCGAGTTATTGGAGTGCTT
TGAAGAAAAGCGACTAGAGGAGACCGCTTCCAAAATGCTTAGTAATCCCT
ACTTTAAGTCCGTTTTGTGGCTGATTGGCTTCGGAGGAATGGGGTACGGC
CTAATGGTGTTAACCGAGCCGAACGTCGACAAGTTAGAGCGCATCAAAGC
CTCCGTTTCAAGTACCAAACTGAGTGCGGATGAGCAGCGAAAGGCTCTGT
TTATGAAGAAGCTCCAGGAGGCGTCCACCACCAGTGCCCCAATCTACAGG
TCATCGTCCGAGAAATAGGATAGTTAGGAAGCTTAATCGTCATCAATTTA
TCAATTTGTTATACTTTTTAAATACAAATGTTAAGCATTTAAAAAAAAAA
AAAAAAAAAAA

LP21834.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG15386-RA 676 CG15386-RA 1..676 15..690 3380 100 Plus
CG42371-RA 676 CG42371-RA 1..676 15..690 3380 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:56:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2216232..2216690 690..232 2205 98.7 Minus
chr2L 23010047 chr2L 2216742..2216958 233..15 1030 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:59:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2216501..2216961 692..232 2305 100 Minus
2L 23513712 2L 2217013..2217231 233..15 1095 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2216501..2216961 692..232 2305 100 Minus
2L 23513712 2L 2217013..2217231 233..15 1095 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:56:32 has no hits.

LP21834.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:57:22 Download gff for LP21834.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2216232..2216688 234..690 98 <- Minus
chr2L 2216742..2216958 15..233 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-21 13:17:03 Download gff for LP21834.complete
Subject Subject Range Query Range Percent Splice Strand
CG42371-RA 1..264 104..367 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:29:18 Download gff for LP21834.complete
Subject Subject Range Query Range Percent Splice Strand
CG42371-RA 1..264 104..367 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:05:17 Download gff for LP21834.complete
Subject Subject Range Query Range Percent Splice Strand
CG42371-RA 1..264 104..367 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:21:03 Download gff for LP21834.complete
Subject Subject Range Query Range Percent Splice Strand
CG42371-RA 1..264 104..367 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-21 13:17:03 Download gff for LP21834.complete
Subject Subject Range Query Range Percent Splice Strand
CG42371-RA 1..676 15..690 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:29:18 Download gff for LP21834.complete
Subject Subject Range Query Range Percent Splice Strand
CG15386-RA 1..676 15..690 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:05:17 Download gff for LP21834.complete
Subject Subject Range Query Range Percent Splice Strand
CG15386-RA 16..691 15..690 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:21:03 Download gff for LP21834.complete
Subject Subject Range Query Range Percent Splice Strand
CG15386-RA 16..691 15..690 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:57:22 Download gff for LP21834.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2216503..2216959 234..690 100 <- Minus
2L 2217013..2217231 15..233 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:57:22 Download gff for LP21834.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2216503..2216959 234..690 100 <- Minus
2L 2217013..2217231 15..233 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:57:22 Download gff for LP21834.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2216503..2216959 234..690 100 <- Minus
2L 2217013..2217231 15..233 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:05:17 Download gff for LP21834.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2216503..2216959 234..690 100 <- Minus
arm_2L 2217013..2217231 15..233 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:02:08 Download gff for LP21834.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2216503..2216959 234..690 100 <- Minus
2L 2217013..2217231 15..233 100   Minus

LP21834.pep Sequence

Translation from 384 to 617

> LP21834.pep
MLSNPYFKSVLWLIGFGGMGYGLMVLTEPNVDKLERIKASVSSTKLSADE
QRKALFMKKLQEASTTSAPIYRSSSEK*

LP21834.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:06:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19705-PA 83 GF19705-PA 1..77 1..76 309 75.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:06:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24546-PA 77 GG24546-PA 1..77 1..77 353 87 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:06:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11468-PA 84 GH11468-PA 1..75 1..74 199 62.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG15386-PA 77 CG15386-PA 1..77 1..77 383 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:06:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16908-PA 79 GI16908-PA 1..69 1..72 244 65.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:06:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19414-PA 81 GL19414-PA 1..76 1..75 266 63.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:06:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13692-PA 81 GA13692-PA 1..76 1..75 266 63.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:06:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18254-PA 77 GM18254-PA 1..77 1..77 389 97.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:06:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22863-PA 77 GD22863-PA 1..77 1..77 390 96.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:06:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17209-PA 82 GJ17209-PA 1..75 1..75 282 66.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:06:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19041-PA 84 GK19041-PA 1..75 1..75 285 68 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:06:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15193-PA 77 GE15193-PA 1..77 1..77 362 88.3 Plus