Clone LP22492 Report

Search the DGRC for LP22492

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:224
Well:92
Vector:pOT2
Associated Gene/TranscriptCG1969-RE
Protein status:LP22492.pep: gold
Sequenced Size:871

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1969-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

LP22492.complete Sequence

871 bp assembled on 2009-08-13

GenBank Submission: BT099584.1

> LP22492.complete
CGGCCGGAAAAACTTCCGCTTCATTTTGTTAGTTTCGTTGCGGGAGATTG
GGAAAAGTGCTAACGGGTGCTTCACTATCATTATCAGACATTAGATAAAA
TCATGGAGGAGACATATCTGTACGATCCTAATCTGCTGCTAAAGCTGGAC
TTTCATCGCAGTCCCGCCAACTTTAAGCCCTTCATATCGGCGGCCAATCC
CGGCGAGCCCTGGATGAAAGTGCGTCCTCTCAAGGACACCGACTACGATC
GTGGATTCCTGCAGCTGCTCTCGCAACTCACCCATGTCGGCAATGTGAAT
CGTACGCAGTTCTTGACCCGCTTTTCGCAGATGAAAGCCAGTGGGGACTA
CTTTGTCACCGTCATTGAGGACACTCGCAAGAATGAGATTATTGGAGCTG
CATCCTTGGTGATCGAGCGCAAGTTCATCCATAACTGTGCTGTGCGTGGC
CGTCTAGAGGATGTGGTGGTCAATGACACGTATCGCGGGAAGCAACTGGG
AAAACTGATCGTGGTCACCGTATCGCTGCTGGCCGAGGAACTGGGCTGCT
ACAAAATGTCGCTGGACTGCAAGGACAAGCTGATCAAGTTCTATGAGTCG
CTGGGCTATGTGGCCATTCCCGGAAACTCCAACTCCATGACGATTCGCTA
CGATGAGGGGCCAACGCTCAAGCGGAATGCTACCTCAGCCGGCTCCAGTG
GAACAGTGGGCGACTCCTGCCAAACTGTGGTTGTAATATTACCTTTTAAG
AGCACCTTCATCAAGTAGCCCTAAGATTGAAACACTCGCATAACTGTTAA
ACTGTTATTAACACTAATCAACAATAGCGATTAAAACCCAATACGAATCT
TTCAAAAAAAAAAAAAAAAAA

LP22492.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:30:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG1969.i 2970 CG1969.i 1662..2390 1..729 3645 100 Plus
CG1969.g 1799 CG1969.g 491..1219 1..729 3645 100 Plus
CG1969-RB 1455 CG1969-RB 147..875 1..729 3645 100 Plus
CG1969.i 2970 CG1969.i 2786..2917 727..858 660 100 Plus
CG1969.g 1799 CG1969.g 1615..1746 727..858 660 100 Plus
CG1969-RB 1455 CG1969-RB 1271..1402 727..858 660 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25563752..25563974 507..729 1055 98.2 Plus
chr3R 27901430 chr3R 25563169..25563380 105..316 1030 99.1 Plus
chr3R 27901430 chr3R 25564370..25564496 727..853 590 97.6 Plus
chr3R 27901430 chr3R 25563442..25563569 317..444 580 96.9 Plus
chr3R 27901430 chr3R 25562477..25562582 1..106 515 99.1 Plus
chr3R 27901430 chr3R 25563630..25563693 444..507 305 98.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:59:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29741150..29741372 507..729 1115 100 Plus
3R 32079331 3R 29740567..29740778 105..316 1060 100 Plus
3R 32079331 3R 29741768..29741899 727..858 660 100 Plus
3R 32079331 3R 29740840..29740967 317..444 640 100 Plus
3R 32079331 3R 29739875..29739980 1..106 530 100 Plus
3R 32079331 3R 29741028..29741091 444..507 320 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:26:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29481981..29482203 507..729 1115 100 Plus
3R 31820162 3R 29481398..29481609 105..316 1060 100 Plus
3R 31820162 3R 29482599..29482730 727..858 660 100 Plus
3R 31820162 3R 29481671..29481798 317..444 640 100 Plus
3R 31820162 3R 29480706..29480811 1..106 530 100 Plus
3R 31820162 3R 29481859..29481922 444..507 320 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:16:28 has no hits.

LP22492.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:17:14 Download gff for LP22492.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25563752..25563971 507..726 98 -> Plus
chr3R 25564370..25564496 727..853 97   Plus
chr3R 25562477..25562581 1..105 99 -> Plus
chr3R 25563170..25563380 106..316 99 -> Plus
chr3R 25563442..25563569 317..444 96 -> Plus
chr3R 25563631..25563692 445..506 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:14:05 Download gff for LP22492.complete
Subject Subject Range Query Range Percent Splice Strand
CG1969-RB 1..627 103..729 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:58:43 Download gff for LP22492.complete
Subject Subject Range Query Range Percent Splice Strand
CG1969-RB 1..627 103..729 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:47:42 Download gff for LP22492.complete
Subject Subject Range Query Range Percent Splice Strand
CG1969-RE 1..666 103..768 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:36:41 Download gff for LP22492.complete
Subject Subject Range Query Range Percent Splice Strand
CG1969-RE 1..666 103..768 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-13 14:56:20 Download gff for LP22492.complete
Subject Subject Range Query Range Percent Splice Strand
CG1969-RB 32..757 1..726 100 -> Plus
CG1969-RB 1156..1282 727..853 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:58:43 Download gff for LP22492.complete
Subject Subject Range Query Range Percent Splice Strand
CG1969-RB 31..756 1..726 100 -> Plus
CG1969-RB 1155..1281 727..853 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:47:42 Download gff for LP22492.complete
Subject Subject Range Query Range Percent Splice Strand
CG1969-RE 33..885 1..853 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:36:41 Download gff for LP22492.complete
Subject Subject Range Query Range Percent Splice Strand
CG1969-RE 33..885 1..853 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:17:14 Download gff for LP22492.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29739875..29739979 1..105 100 -> Plus
3R 29740568..29740778 106..316 100 -> Plus
3R 29740840..29740967 317..444 100 -> Plus
3R 29741029..29741090 445..506 100 -> Plus
3R 29741150..29741369 507..726 100 -> Plus
3R 29741768..29741894 727..853 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:17:14 Download gff for LP22492.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29739875..29739979 1..105 100 -> Plus
3R 29740568..29740778 106..316 100 -> Plus
3R 29740840..29740967 317..444 100 -> Plus
3R 29741029..29741090 445..506 100 -> Plus
3R 29741150..29741369 507..726 100 -> Plus
3R 29741768..29741894 727..853 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:17:14 Download gff for LP22492.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29739875..29739979 1..105 100 -> Plus
3R 29740568..29740778 106..316 100 -> Plus
3R 29740840..29740967 317..444 100 -> Plus
3R 29741029..29741090 445..506 100 -> Plus
3R 29741150..29741369 507..726 100 -> Plus
3R 29741768..29741894 727..853 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:47:42 Download gff for LP22492.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25566290..25566500 106..316 100 -> Plus
arm_3R 25566562..25566689 317..444 100 -> Plus
arm_3R 25566751..25566812 445..506 100 -> Plus
arm_3R 25566872..25567091 507..726 100 -> Plus
arm_3R 25567490..25567616 727..853 100   Plus
arm_3R 25565597..25565701 1..105 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:50:24 Download gff for LP22492.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29481399..29481609 106..316 100 -> Plus
3R 29481671..29481798 317..444 100 -> Plus
3R 29481860..29481921 445..506 100 -> Plus
3R 29480706..29480810 1..105 100 -> Plus
3R 29481981..29482200 507..726 100 -> Plus
3R 29482599..29482725 727..853 100   Plus

LP22492.pep Sequence

Translation from 102 to 767

> LP22492.pep
MEETYLYDPNLLLKLDFHRSPANFKPFISAANPGEPWMKVRPLKDTDYDR
GFLQLLSQLTHVGNVNRTQFLTRFSQMKASGDYFVTVIEDTRKNEIIGAA
SLVIERKFIHNCAVRGRLEDVVVNDTYRGKQLGKLIVVTVSLLAEELGCY
KMSLDCKDKLIKFYESLGYVAIPGNSNSMTIRYDEGPTLKRNATSAGSSG
TVGDSCQTVVVILPFKSTFIK*

LP22492.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:26:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23369-PA 219 GF23369-PA 6..213 2..209 1090 97.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:26:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11689-PA 219 GG11689-PA 6..213 2..209 1114 99.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:26:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14324-PA 219 GH14324-PA 5..213 1..209 984 88.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Gnpnat-PE 221 CG1969-PE 1..221 1..221 1142 100 Plus
Gnpnat-PH 215 CG1969-PH 1..209 1..209 1084 100 Plus
Gnpnat-PG 215 CG1969-PG 1..209 1..209 1084 100 Plus
Gnpnat-PB 215 CG1969-PB 1..209 1..209 1084 100 Plus
Gnpnat-PF 228 CG1969-PF 1..209 1..209 1084 100 Plus
Gnpnat-PA 219 CG1969-PA 6..213 2..209 1079 100 Plus
Gnpnat-PD 225 CG1969-PD 6..223 2..219 1077 96.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10420-PA 219 GI10420-PA 6..213 2..209 982 88 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:26:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13913-PA 222 GL13913-PA 6..216 2..209 998 91.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15162-PB 218 GA15162-PB 1..212 1..209 1005 92 Plus
Dpse\GA15162-PA 222 GA15162-PA 6..216 2..209 998 91.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:26:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12815-PA 219 GM12815-PA 6..213 2..209 1114 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21459-PA 219 GD21459-PA 6..213 2..209 1111 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10636-PA 217 GJ10636-PA 6..211 2..209 970 85.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11919-PA 219 GK11919-PA 6..213 2..209 996 90 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:26:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23878-PA 219 GE23878-PA 6..213 2..209 1118 100 Plus

LP22492.hyp Sequence

Translation from 102 to 767

> LP22492.hyp
MEETYLYDPNLLLKLDFHRSPANFKPFISAANPGEPWMKVRPLKDTDYDR
GFLQLLSQLTHVGNVNRTQFLTRFSQMKASGDYFVTVIEDTRKNEIIGAA
SLVIERKFIHNCAVRGRLEDVVVNDTYRGKQLGKLIVVTVSLLAEELGCY
KMSLDCKDKLIKFYESLGYVAIPGNSNSMTIRYDEGPTLKRNATSAGSSG
TVGDSCQTVVVILPFKSTFIK*

LP22492.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG1969-PE 221 CG1969-PE 1..221 1..221 1142 100 Plus
CG1969-PH 215 CG1969-PH 1..209 1..209 1084 100 Plus
CG1969-PG 215 CG1969-PG 1..209 1..209 1084 100 Plus
CG1969-PB 215 CG1969-PB 1..209 1..209 1084 100 Plus
CG1969-PF 228 CG1969-PF 1..209 1..209 1084 100 Plus