BDGP Sequence Production Resources |
Search the DGRC for LP22492
Library: | LP |
Tissue Source: | Drosophila melanogaster larval-early pupal |
Created by: | Ling Hong |
Date Registered: | 1998-06-11 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 224 |
Well: | 92 |
Vector: | pOT2 |
Associated Gene/Transcript | CG1969-RE |
Protein status: | LP22492.pep: gold |
Sequenced Size: | 871 |
Gene | Date | Evidence |
---|---|---|
CG1969-RB | 2009-06-22 | Replacement based on scoring |
871 bp assembled on 2009-08-13
GenBank Submission: BT099584.1
> LP22492.complete CGGCCGGAAAAACTTCCGCTTCATTTTGTTAGTTTCGTTGCGGGAGATTG GGAAAAGTGCTAACGGGTGCTTCACTATCATTATCAGACATTAGATAAAA TCATGGAGGAGACATATCTGTACGATCCTAATCTGCTGCTAAAGCTGGAC TTTCATCGCAGTCCCGCCAACTTTAAGCCCTTCATATCGGCGGCCAATCC CGGCGAGCCCTGGATGAAAGTGCGTCCTCTCAAGGACACCGACTACGATC GTGGATTCCTGCAGCTGCTCTCGCAACTCACCCATGTCGGCAATGTGAAT CGTACGCAGTTCTTGACCCGCTTTTCGCAGATGAAAGCCAGTGGGGACTA CTTTGTCACCGTCATTGAGGACACTCGCAAGAATGAGATTATTGGAGCTG CATCCTTGGTGATCGAGCGCAAGTTCATCCATAACTGTGCTGTGCGTGGC CGTCTAGAGGATGTGGTGGTCAATGACACGTATCGCGGGAAGCAACTGGG AAAACTGATCGTGGTCACCGTATCGCTGCTGGCCGAGGAACTGGGCTGCT ACAAAATGTCGCTGGACTGCAAGGACAAGCTGATCAAGTTCTATGAGTCG CTGGGCTATGTGGCCATTCCCGGAAACTCCAACTCCATGACGATTCGCTA CGATGAGGGGCCAACGCTCAAGCGGAATGCTACCTCAGCCGGCTCCAGTG GAACAGTGGGCGACTCCTGCCAAACTGTGGTTGTAATATTACCTTTTAAG AGCACCTTCATCAAGTAGCCCTAAGATTGAAACACTCGCATAACTGTTAA ACTGTTATTAACACTAATCAACAATAGCGATTAAAACCCAATACGAATCT TTCAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG1969.i | 2970 | CG1969.i | 1662..2390 | 1..729 | 3645 | 100 | Plus |
CG1969.g | 1799 | CG1969.g | 491..1219 | 1..729 | 3645 | 100 | Plus |
CG1969-RB | 1455 | CG1969-RB | 147..875 | 1..729 | 3645 | 100 | Plus |
CG1969.i | 2970 | CG1969.i | 2786..2917 | 727..858 | 660 | 100 | Plus |
CG1969.g | 1799 | CG1969.g | 1615..1746 | 727..858 | 660 | 100 | Plus |
CG1969-RB | 1455 | CG1969-RB | 1271..1402 | 727..858 | 660 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 25563752..25563974 | 507..729 | 1055 | 98.2 | Plus |
chr3R | 27901430 | chr3R | 25563169..25563380 | 105..316 | 1030 | 99.1 | Plus |
chr3R | 27901430 | chr3R | 25564370..25564496 | 727..853 | 590 | 97.6 | Plus |
chr3R | 27901430 | chr3R | 25563442..25563569 | 317..444 | 580 | 96.9 | Plus |
chr3R | 27901430 | chr3R | 25562477..25562582 | 1..106 | 515 | 99.1 | Plus |
chr3R | 27901430 | chr3R | 25563630..25563693 | 444..507 | 305 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 29741150..29741372 | 507..729 | 1115 | 100 | Plus |
3R | 32079331 | 3R | 29740567..29740778 | 105..316 | 1060 | 100 | Plus |
3R | 32079331 | 3R | 29741768..29741899 | 727..858 | 660 | 100 | Plus |
3R | 32079331 | 3R | 29740840..29740967 | 317..444 | 640 | 100 | Plus |
3R | 32079331 | 3R | 29739875..29739980 | 1..106 | 530 | 100 | Plus |
3R | 32079331 | 3R | 29741028..29741091 | 444..507 | 320 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 29481981..29482203 | 507..729 | 1115 | 100 | Plus |
3R | 31820162 | 3R | 29481398..29481609 | 105..316 | 1060 | 100 | Plus |
3R | 31820162 | 3R | 29482599..29482730 | 727..858 | 660 | 100 | Plus |
3R | 31820162 | 3R | 29481671..29481798 | 317..444 | 640 | 100 | Plus |
3R | 31820162 | 3R | 29480706..29480811 | 1..106 | 530 | 100 | Plus |
3R | 31820162 | 3R | 29481859..29481922 | 444..507 | 320 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 25563752..25563971 | 507..726 | 98 | -> | Plus |
chr3R | 25564370..25564496 | 727..853 | 97 | Plus | |
chr3R | 25562477..25562581 | 1..105 | 99 | -> | Plus |
chr3R | 25563170..25563380 | 106..316 | 99 | -> | Plus |
chr3R | 25563442..25563569 | 317..444 | 96 | -> | Plus |
chr3R | 25563631..25563692 | 445..506 | 98 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1969-RB | 1..627 | 103..729 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1969-RB | 1..627 | 103..729 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1969-RE | 1..666 | 103..768 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1969-RE | 1..666 | 103..768 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1969-RB | 32..757 | 1..726 | 100 | -> | Plus |
CG1969-RB | 1156..1282 | 727..853 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1969-RB | 31..756 | 1..726 | 100 | -> | Plus |
CG1969-RB | 1155..1281 | 727..853 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1969-RE | 33..885 | 1..853 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG1969-RE | 33..885 | 1..853 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29739875..29739979 | 1..105 | 100 | -> | Plus |
3R | 29740568..29740778 | 106..316 | 100 | -> | Plus |
3R | 29740840..29740967 | 317..444 | 100 | -> | Plus |
3R | 29741029..29741090 | 445..506 | 100 | -> | Plus |
3R | 29741150..29741369 | 507..726 | 100 | -> | Plus |
3R | 29741768..29741894 | 727..853 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29739875..29739979 | 1..105 | 100 | -> | Plus |
3R | 29740568..29740778 | 106..316 | 100 | -> | Plus |
3R | 29740840..29740967 | 317..444 | 100 | -> | Plus |
3R | 29741029..29741090 | 445..506 | 100 | -> | Plus |
3R | 29741150..29741369 | 507..726 | 100 | -> | Plus |
3R | 29741768..29741894 | 727..853 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29739875..29739979 | 1..105 | 100 | -> | Plus |
3R | 29740568..29740778 | 106..316 | 100 | -> | Plus |
3R | 29740840..29740967 | 317..444 | 100 | -> | Plus |
3R | 29741029..29741090 | 445..506 | 100 | -> | Plus |
3R | 29741150..29741369 | 507..726 | 100 | -> | Plus |
3R | 29741768..29741894 | 727..853 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 25566290..25566500 | 106..316 | 100 | -> | Plus |
arm_3R | 25566562..25566689 | 317..444 | 100 | -> | Plus |
arm_3R | 25566751..25566812 | 445..506 | 100 | -> | Plus |
arm_3R | 25566872..25567091 | 507..726 | 100 | -> | Plus |
arm_3R | 25567490..25567616 | 727..853 | 100 | Plus | |
arm_3R | 25565597..25565701 | 1..105 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29481399..29481609 | 106..316 | 100 | -> | Plus |
3R | 29481671..29481798 | 317..444 | 100 | -> | Plus |
3R | 29481860..29481921 | 445..506 | 100 | -> | Plus |
3R | 29480706..29480810 | 1..105 | 100 | -> | Plus |
3R | 29481981..29482200 | 507..726 | 100 | -> | Plus |
3R | 29482599..29482725 | 727..853 | 100 | Plus |
Translation from 102 to 767
> LP22492.pep MEETYLYDPNLLLKLDFHRSPANFKPFISAANPGEPWMKVRPLKDTDYDR GFLQLLSQLTHVGNVNRTQFLTRFSQMKASGDYFVTVIEDTRKNEIIGAA SLVIERKFIHNCAVRGRLEDVVVNDTYRGKQLGKLIVVTVSLLAEELGCY KMSLDCKDKLIKFYESLGYVAIPGNSNSMTIRYDEGPTLKRNATSAGSSG TVGDSCQTVVVILPFKSTFIK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23369-PA | 219 | GF23369-PA | 6..213 | 2..209 | 1090 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11689-PA | 219 | GG11689-PA | 6..213 | 2..209 | 1114 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14324-PA | 219 | GH14324-PA | 5..213 | 1..209 | 984 | 88.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Gnpnat-PE | 221 | CG1969-PE | 1..221 | 1..221 | 1142 | 100 | Plus |
Gnpnat-PH | 215 | CG1969-PH | 1..209 | 1..209 | 1084 | 100 | Plus |
Gnpnat-PG | 215 | CG1969-PG | 1..209 | 1..209 | 1084 | 100 | Plus |
Gnpnat-PB | 215 | CG1969-PB | 1..209 | 1..209 | 1084 | 100 | Plus |
Gnpnat-PF | 228 | CG1969-PF | 1..209 | 1..209 | 1084 | 100 | Plus |
Gnpnat-PA | 219 | CG1969-PA | 6..213 | 2..209 | 1079 | 100 | Plus |
Gnpnat-PD | 225 | CG1969-PD | 6..223 | 2..219 | 1077 | 96.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10420-PA | 219 | GI10420-PA | 6..213 | 2..209 | 982 | 88 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13913-PA | 222 | GL13913-PA | 6..216 | 2..209 | 998 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15162-PB | 218 | GA15162-PB | 1..212 | 1..209 | 1005 | 92 | Plus |
Dpse\GA15162-PA | 222 | GA15162-PA | 6..216 | 2..209 | 998 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12815-PA | 219 | GM12815-PA | 6..213 | 2..209 | 1114 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21459-PA | 219 | GD21459-PA | 6..213 | 2..209 | 1111 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10636-PA | 217 | GJ10636-PA | 6..211 | 2..209 | 970 | 85.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11919-PA | 219 | GK11919-PA | 6..213 | 2..209 | 996 | 90 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23878-PA | 219 | GE23878-PA | 6..213 | 2..209 | 1118 | 100 | Plus |
Translation from 102 to 767
> LP22492.hyp MEETYLYDPNLLLKLDFHRSPANFKPFISAANPGEPWMKVRPLKDTDYDR GFLQLLSQLTHVGNVNRTQFLTRFSQMKASGDYFVTVIEDTRKNEIIGAA SLVIERKFIHNCAVRGRLEDVVVNDTYRGKQLGKLIVVTVSLLAEELGCY KMSLDCKDKLIKFYESLGYVAIPGNSNSMTIRYDEGPTLKRNATSAGSSG TVGDSCQTVVVILPFKSTFIK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG1969-PE | 221 | CG1969-PE | 1..221 | 1..221 | 1142 | 100 | Plus |
CG1969-PH | 215 | CG1969-PH | 1..209 | 1..209 | 1084 | 100 | Plus |
CG1969-PG | 215 | CG1969-PG | 1..209 | 1..209 | 1084 | 100 | Plus |
CG1969-PB | 215 | CG1969-PB | 1..209 | 1..209 | 1084 | 100 | Plus |
CG1969-PF | 228 | CG1969-PF | 1..209 | 1..209 | 1084 | 100 | Plus |