Clone LP22624 Report

Search the DGRC for LP22624

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:226
Well:24
Vector:pOT2
Associated Gene/TranscriptCG34232-RB
Protein status:LP22624.pep: gold
Sequenced Size:812

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34232-RB 2009-06-22 Replacement based on scoring

Clone Sequence Records

LP22624.complete Sequence

812 bp assembled on 2009-10-29

GenBank Submission: BT100180.1

> LP22624.complete
AGAGCTTTGCATCGCAGAAACAGAAGAAGAAGAAGGCATTGAAGTCCATA
TCCTATACCGAAGCTATCATGTTGAAGGCGGTGAGTGTGTGGTTCCAAGG
GGCGGACCTAATCTAATCGCCGGTTCAGATATGAAAGTGGCTTCAATTTA
ATTTACTATCAATACCCATCGATTCACCTTGATTACTCCGGATGTTTGGC
CCGCTGCAGATTATCGTTTTTGCCACTATCTTGGTGGCCGTGGCCATGGC
CATGCAGCCACTGGAGGACAATGAGCGAACCCATCATCTGAACCACAAGC
GCCAGTTGTCGCAACAGCACCACCACCACCACCAAAAGCTCCAGGAGGTG
AGGCATTCGGGCCATGATAGTCTGAAACATGGTGGTTCCCACGTTAAGGA
GCATCAAGCGCATCACTCTGAGCGAAAGGCCAGGCAGAGCCACAAGGAGC
CGGGCCACAAGAAGAGTCACCACCAGAAGGAGCACCGCCAGCAGCAGGAC
AACCACACCCGCAAATCCCGATCGCATTCCAAGGGCAGCAAGCAGCATCA
CAAGCGGCACACGGGATCGCGTCGCCACTAGGATAATCCTGTATCCTGTG
GCCAGGATATATTCTATTTAAACTCTAGCCAATGGATTCCTTATGCGAGG
ATTAAACTCCGAATACAGTAAACACTCGTATAATTGCATGTATGGCAACA
GTAAAGCCAATCTATTTAAATGTTTACAAAACTACTGTGAAATATAAGCC
ATGACCAAATAAACACACATTTCATAAATGATATTAATATCCACAAAAAA
AAAAAAAAAAAA

LP22624.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG34232-RB 636 CG34232-RB 1..636 1..636 3180 100 Plus
CG34232.a 1027 CG34232.a 396..983 209..796 2940 100 Plus
CG34232-RA 813 CG34232-RA 182..769 209..796 2940 100 Plus
CG34232.a 1027 CG34232.a 317..396 1..80 400 100 Plus
CG34232-RA 813 CG34232-RA 103..182 1..80 400 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8052124..8052917 794..1 3895 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:59:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12164907..12165702 796..1 3980 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12166106..12166901 796..1 3980 100 Minus
Blast to na_te.dros performed 2019-03-16 18:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
rooA 7621 rooA ROOA_LTR 7621bp 5006..5072 647..717 128 70.4 Plus
gypsy12 10218 gypsy12 GYPSY12 10218bp 696..737 476..517 111 73.8 Plus
gypsy12 10218 gypsy12 GYPSY12 10218bp 8578..8619 476..517 111 73.8 Plus

LP22624.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:02:40 Download gff for LP22624.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8052124..8052917 1..794 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-29 11:34:32 Download gff for LP22624.complete
Subject Subject Range Query Range Percent Splice Strand
CG34232-RB 1..390 192..581 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:14:36 Download gff for LP22624.complete
Subject Subject Range Query Range Percent Splice Strand
CG34232-RB 1..390 192..581 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:43:27 Download gff for LP22624.complete
Subject Subject Range Query Range Percent Splice Strand
CG34232-RB 1..390 192..581 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:26:55 Download gff for LP22624.complete
Subject Subject Range Query Range Percent Splice Strand
CG34232-RB 1..390 192..581 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-29 11:34:32 Download gff for LP22624.complete
Subject Subject Range Query Range Percent Splice Strand
CG34232-RB 1..636 1..636 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:14:35 Download gff for LP22624.complete
Subject Subject Range Query Range Percent Splice Strand
CG34232-RB 1..636 1..636 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:43:27 Download gff for LP22624.complete
Subject Subject Range Query Range Percent Splice Strand
CG34232-RB 18..811 1..794 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:26:55 Download gff for LP22624.complete
Subject Subject Range Query Range Percent Splice Strand
CG34232-RB 38..831 1..794 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:02:40 Download gff for LP22624.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12164909..12165702 1..794 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:02:40 Download gff for LP22624.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12164909..12165702 1..794 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:02:40 Download gff for LP22624.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12164909..12165702 1..794 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:43:27 Download gff for LP22624.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8052414..8053207 1..794 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:04:54 Download gff for LP22624.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12166108..12166901 1..794 100   Minus

LP22624.pep Sequence

Translation from 191 to 580

> LP22624.pep
MFGPLQIIVFATILVAVAMAMQPLEDNERTHHLNHKRQLSQQHHHHHQKL
QEVRHSGHDSLKHGGSHVKEHQAHHSERKARQSHKEPGHKKSHHQKEHRQ
QQDNHTRKSRSHSKGSKQHHKRHTGSRRH*

LP22624.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12640-PA 126 GF12640-PA 5..102 7..81 152 48 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22603-PA 122 GG22603-PA 5..122 7..129 387 70.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34232-PB 129 CG34232-PB 1..129 1..129 711 100 Plus
CG34232-PC 127 CG34232-PC 5..127 7..129 678 100 Plus
CG34232-PA 127 CG34232-PA 5..127 7..129 678 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20382-PA 127 GM20382-PA 5..127 7..129 471 91.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25856-PA 127 GD25856-PA 5..127 7..129 522 93.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13471-PA 133 GE13471-PA 5..133 7..129 469 78.9 Plus

LP22624.hyp Sequence

Translation from 191 to 580

> LP22624.hyp
MFGPLQIIVFATILVAVAMAMQPLEDNERTHHLNHKRQLSQQHHHHHQKL
QEVRHSGHDSLKHGGSHVKEHQAHHSERKARQSHKEPGHKKSHHQKEHRQ
QQDNHTRKSRSHSKGSKQHHKRHTGSRRH*

LP22624.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG34232-PB 129 CG34232-PB 1..129 1..129 711 100 Plus
CG34232-PC 127 CG34232-PC 5..127 7..129 678 100 Plus
CG34232-PA 127 CG34232-PA 5..127 7..129 678 100 Plus