LP22678.complete Sequence
429 bp (429 high quality bases) assembled on 2004-01-31
GenBank Submission: BT011533
> LP22678.complete
TCATTGGATGTTCCCGTATCGAAAGTGAAAATGCGTTCCGCGATTTTGTT
CGGCCTTATTGTTTGCCTGGCTTTTAGCCTTGTCTTGTCCCTGGAGGAGT
CCATCAATCAATCCAATGATCTGTCGTCGGTGGAAAAGGATATTGGCCAG
GCTGTGGAGTCCGATGTGCGTGCTAAGCGGCAGTTTGGCTTTGGTGGTCC
CTTTGGCGGATTTGGAGGACCTTTCGGTGGATACGGCGGCTACGGAGGAC
TTGGAGGCTTTGGTTATGGACGTCCCTTCTATGGAGGCTATGGCCGTCCC
TTCTATGGAGGTTTCGGAAGACCCTTCTACGGAGGCGGCTTCGGAGGTCC
TTTCTTTGGTTAAATCTACTAATACTTATATTGTTTTACCAATAAACTAA
GACTGAAAACGAAAAAAAAAAAAAAAAAA
LP22678.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:09:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17738-RA | 411 | CG17738-RA | 1..411 | 1..411 | 2055 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:27:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 8096277..8096687 | 1..411 | 2055 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:59:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:27:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 12270890..12271303 | 1..414 | 2070 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:04:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 12011721..12012134 | 1..414 | 2070 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 12:27:39 has no hits.
LP22678.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:28:25 Download gff for
LP22678.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 8096277..8096687 | 1..411 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:44:39 Download gff for
LP22678.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17738-RA | 1..333 | 31..363 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:14:39 Download gff for
LP22678.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17738-RA | 1..333 | 31..363 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:26:53 Download gff for
LP22678.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17738-RA | 1..333 | 31..363 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:46:16 Download gff for
LP22678.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17738-RA | 1..333 | 31..363 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:43:10 Download gff for
LP22678.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17738-RA | 1..411 | 1..411 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:14:39 Download gff for
LP22678.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17738-RA | 1..411 | 1..411 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:26:53 Download gff for
LP22678.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17738-RA | 1..411 | 1..411 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:25:05 Download gff for
LP22678.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17738-RA | 1..333 | 31..363 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:46:16 Download gff for
LP22678.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17738-RA | 1..411 | 1..411 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:25 Download gff for
LP22678.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12270890..12271300 | 1..411 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:25 Download gff for
LP22678.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12270890..12271300 | 1..411 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:25 Download gff for
LP22678.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12270890..12271300 | 1..411 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:26:53 Download gff for
LP22678.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 8096612..8097022 | 1..411 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:45:30 Download gff for
LP22678.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12011721..12012131 | 1..411 | 100 | | Plus |
LP22678.hyp Sequence
Translation from 0 to 362
> LP22678.hyp
SLDVPVSKVKMRSAILFGLIVCLAFSLVLSLEESINQSNDLSSVEKDIGQ
AVESDVRAKRQFGFGGPFGGFGGPFGGYGGYGGLGGFGYGRPFYGGYGRP
FYGGFGRPFYGGGFGGPFFG*
LP22678.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17738-PA | 110 | CG17738-PA | 1..110 | 11..120 | 602 | 100 | Plus |
CG9757-PB | 127 | CG9757-PB | 5..127 | 21..120 | 178 | 40.5 | Plus |
CG9757-PA | 127 | CG9757-PA | 5..127 | 21..120 | 178 | 40.5 | Plus |
CG9269-PA | 146 | CG9269-PA | 1..117 | 11..118 | 164 | 35.5 | Plus |
CG7294-PA | 127 | CG7294-PA | 14..73 | 56..120 | 159 | 60.6 | Plus |
LP22678.pep Sequence
Translation from 30 to 362
> LP22678.pep
MRSAILFGLIVCLAFSLVLSLEESINQSNDLSSVEKDIGQAVESDVRAKR
QFGFGGPFGGFGGPFGGYGGYGGLGGFGYGRPFYGGYGRPFYGGFGRPFY
GGGFGGPFFG*
LP22678.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:31:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF17238-PA | 109 | GF17238-PA | 1..53 | 1..53 | 212 | 84.9 | Plus |
Dana\GF17239-PA | 113 | GF17239-PA | 1..53 | 1..53 | 194 | 69.8 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:31:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG18696-PA | 111 | GG18696-PA | 1..92 | 1..92 | 267 | 91.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17738-PA | 110 | CG17738-PA | 1..110 | 1..110 | 602 | 100 | Plus |
CG9757-PB | 127 | CG9757-PB | 5..127 | 11..110 | 178 | 40.5 | Plus |
CG9757-PA | 127 | CG9757-PA | 5..127 | 11..110 | 178 | 40.5 | Plus |
CG9269-PA | 146 | CG9269-PA | 1..117 | 1..108 | 164 | 35.5 | Plus |
CG7294-PA | 127 | CG7294-PA | 14..73 | 46..110 | 159 | 60.6 | Plus |
CG17777-PC | 110 | CG17777-PC | 48..98 | 60..105 | 147 | 54.7 | Plus |
CG17777-PB | 110 | CG17777-PB | 48..98 | 60..105 | 147 | 54.7 | Plus |
CG13217-PA | 113 | CG13217-PA | 5..100 | 4..106 | 147 | 38.5 | Plus |
CG7299-PC | 177 | CG7299-PC | 68..126 | 51..106 | 147 | 60.7 | Plus |
CG7299-PA | 177 | CG7299-PA | 68..126 | 51..106 | 147 | 60.7 | Plus |
CG9877-PA | 88 | CG9877-PA | 25..88 | 51..110 | 144 | 50 | Plus |
CG9759-PB | 112 | CG9759-PB | 14..112 | 8..110 | 141 | 43.4 | Plus |
CG9759-PC | 112 | CG9759-PC | 14..112 | 8..110 | 141 | 43.4 | Plus |
CG9759-PA | 112 | CG9759-PA | 14..112 | 8..110 | 141 | 43.4 | Plus |
Vm26Ac-PA | 181 | CG13997-PA | 59..122 | 40..110 | 140 | 52 | Plus |
CG7296-PB | 161 | CG7296-PB | 5..109 | 13..110 | 136 | 37.4 | Plus |
CG7296-PA | 161 | CG7296-PA | 5..109 | 13..110 | 136 | 37.4 | Plus |
CG7294-PA | 127 | CG7294-PA | 26..87 | 53..106 | 135 | 55.6 | Plus |
CG8157-PB | 113 | CG8157-PB | 25..81 | 51..106 | 134 | 58.6 | Plus |
CG8157-PA | 113 | CG8157-PA | 25..81 | 51..106 | 134 | 58.6 | Plus |
CG34281-PA | 106 | CG34281-PA | 22..81 | 51..105 | 133 | 47.8 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:32:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM24008-PA | 110 | GM24008-PA | 1..110 | 1..110 | 505 | 97.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:32:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD18807-PA | 113 | GD18807-PA | 1..98 | 1..95 | 278 | 92.9 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:32:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE26168-PA | 89 | GE26168-PA | 1..89 | 1..93 | 182 | 52.1 | Plus |