Clone LP22678 Report

Search the DGRC for LP22678

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:226
Well:78
Vector:pOT2
Associated Gene/TranscriptCG17738-RA
Protein status:LP22678.pep: gold
Sequenced Size:429

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17738 2003-01-01 Sim4 clustering to Release 3
CG17738 2004-01-31 Blastp of sequenced clone
CG17738 2008-04-29 Release 5.5 accounting
CG17738 2008-08-15 Release 5.9 accounting
CG17738 2008-12-18 5.12 accounting

Clone Sequence Records

LP22678.complete Sequence

429 bp (429 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011533

> LP22678.complete
TCATTGGATGTTCCCGTATCGAAAGTGAAAATGCGTTCCGCGATTTTGTT
CGGCCTTATTGTTTGCCTGGCTTTTAGCCTTGTCTTGTCCCTGGAGGAGT
CCATCAATCAATCCAATGATCTGTCGTCGGTGGAAAAGGATATTGGCCAG
GCTGTGGAGTCCGATGTGCGTGCTAAGCGGCAGTTTGGCTTTGGTGGTCC
CTTTGGCGGATTTGGAGGACCTTTCGGTGGATACGGCGGCTACGGAGGAC
TTGGAGGCTTTGGTTATGGACGTCCCTTCTATGGAGGCTATGGCCGTCCC
TTCTATGGAGGTTTCGGAAGACCCTTCTACGGAGGCGGCTTCGGAGGTCC
TTTCTTTGGTTAAATCTACTAATACTTATATTGTTTTACCAATAAACTAA
GACTGAAAACGAAAAAAAAAAAAAAAAAA

LP22678.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG17738-RA 411 CG17738-RA 1..411 1..411 2055 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8096277..8096687 1..411 2055 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:59:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12270890..12271303 1..414 2070 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:04:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12011721..12012134 1..414 2070 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:27:39 has no hits.

LP22678.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:28:25 Download gff for LP22678.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8096277..8096687 1..411 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:44:39 Download gff for LP22678.complete
Subject Subject Range Query Range Percent Splice Strand
CG17738-RA 1..333 31..363 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:14:39 Download gff for LP22678.complete
Subject Subject Range Query Range Percent Splice Strand
CG17738-RA 1..333 31..363 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:26:53 Download gff for LP22678.complete
Subject Subject Range Query Range Percent Splice Strand
CG17738-RA 1..333 31..363 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:46:16 Download gff for LP22678.complete
Subject Subject Range Query Range Percent Splice Strand
CG17738-RA 1..333 31..363 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:43:10 Download gff for LP22678.complete
Subject Subject Range Query Range Percent Splice Strand
CG17738-RA 1..411 1..411 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:14:39 Download gff for LP22678.complete
Subject Subject Range Query Range Percent Splice Strand
CG17738-RA 1..411 1..411 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:26:53 Download gff for LP22678.complete
Subject Subject Range Query Range Percent Splice Strand
CG17738-RA 1..411 1..411 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:25:05 Download gff for LP22678.complete
Subject Subject Range Query Range Percent Splice Strand
CG17738-RA 1..333 31..363 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:46:16 Download gff for LP22678.complete
Subject Subject Range Query Range Percent Splice Strand
CG17738-RA 1..411 1..411 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:25 Download gff for LP22678.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12270890..12271300 1..411 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:25 Download gff for LP22678.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12270890..12271300 1..411 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:25 Download gff for LP22678.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12270890..12271300 1..411 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:26:53 Download gff for LP22678.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8096612..8097022 1..411 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:45:30 Download gff for LP22678.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12011721..12012131 1..411 100   Plus

LP22678.hyp Sequence

Translation from 0 to 362

> LP22678.hyp
SLDVPVSKVKMRSAILFGLIVCLAFSLVLSLEESINQSNDLSSVEKDIGQ
AVESDVRAKRQFGFGGPFGGFGGPFGGYGGYGGLGGFGYGRPFYGGYGRP
FYGGFGRPFYGGGFGGPFFG*

LP22678.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG17738-PA 110 CG17738-PA 1..110 11..120 602 100 Plus
CG9757-PB 127 CG9757-PB 5..127 21..120 178 40.5 Plus
CG9757-PA 127 CG9757-PA 5..127 21..120 178 40.5 Plus
CG9269-PA 146 CG9269-PA 1..117 11..118 164 35.5 Plus
CG7294-PA 127 CG7294-PA 14..73 56..120 159 60.6 Plus

LP22678.pep Sequence

Translation from 30 to 362

> LP22678.pep
MRSAILFGLIVCLAFSLVLSLEESINQSNDLSSVEKDIGQAVESDVRAKR
QFGFGGPFGGFGGPFGGYGGYGGLGGFGYGRPFYGGYGRPFYGGFGRPFY
GGGFGGPFFG*

LP22678.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:31:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17238-PA 109 GF17238-PA 1..53 1..53 212 84.9 Plus
Dana\GF17239-PA 113 GF17239-PA 1..53 1..53 194 69.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:31:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18696-PA 111 GG18696-PA 1..92 1..92 267 91.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG17738-PA 110 CG17738-PA 1..110 1..110 602 100 Plus
CG9757-PB 127 CG9757-PB 5..127 11..110 178 40.5 Plus
CG9757-PA 127 CG9757-PA 5..127 11..110 178 40.5 Plus
CG9269-PA 146 CG9269-PA 1..117 1..108 164 35.5 Plus
CG7294-PA 127 CG7294-PA 14..73 46..110 159 60.6 Plus
CG17777-PC 110 CG17777-PC 48..98 60..105 147 54.7 Plus
CG17777-PB 110 CG17777-PB 48..98 60..105 147 54.7 Plus
CG13217-PA 113 CG13217-PA 5..100 4..106 147 38.5 Plus
CG7299-PC 177 CG7299-PC 68..126 51..106 147 60.7 Plus
CG7299-PA 177 CG7299-PA 68..126 51..106 147 60.7 Plus
CG9877-PA 88 CG9877-PA 25..88 51..110 144 50 Plus
CG9759-PB 112 CG9759-PB 14..112 8..110 141 43.4 Plus
CG9759-PC 112 CG9759-PC 14..112 8..110 141 43.4 Plus
CG9759-PA 112 CG9759-PA 14..112 8..110 141 43.4 Plus
Vm26Ac-PA 181 CG13997-PA 59..122 40..110 140 52 Plus
CG7296-PB 161 CG7296-PB 5..109 13..110 136 37.4 Plus
CG7296-PA 161 CG7296-PA 5..109 13..110 136 37.4 Plus
CG7294-PA 127 CG7294-PA 26..87 53..106 135 55.6 Plus
CG8157-PB 113 CG8157-PB 25..81 51..106 134 58.6 Plus
CG8157-PA 113 CG8157-PA 25..81 51..106 134 58.6 Plus
CG34281-PA 106 CG34281-PA 22..81 51..105 133 47.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24008-PA 110 GM24008-PA 1..110 1..110 505 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18807-PA 113 GD18807-PA 1..98 1..95 278 92.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:32:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26168-PA 89 GE26168-PA 1..89 1..93 182 52.1 Plus