Clone LP22717 Report

Search the DGRC for LP22717

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:227
Well:17
Vector:pOT2
Associated Gene/TranscriptCG5548-RA
Protein status:LP22717.pep: gold
Sequenced Size:566

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5548 2003-01-01 Sim4 clustering to Release 3
CG5548 2004-01-31 Blastp of sequenced clone
CG5548 2008-04-29 Release 5.5 accounting
CG5548 2008-08-15 Release 5.9 accounting
CG5548 2008-12-18 5.12 accounting

Clone Sequence Records

LP22717.complete Sequence

566 bp (566 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011534

> LP22717.complete
AACTTTGACAGCTGCGGCGCAACCGAAATCTAAGAAAAACAATTTACGAT
GGGCAACGCGCTGACGCACTACATGAAACCGGACGTGATGCCCGGCCCGG
ACGTGGTGCCCACCTTTGACCCACTGCTGGGCTTCAAGTCGCGCAAGGAG
CGTGTGATGATCGCCACCCAGGAGGAGATGGAGTCCGCCAAGCTGCCGCT
GGAATTCCGCGACTACTGCGCCCACCTGGCTATCGCCTACCAGGCCTGCC
GCAGCGACACCTTCCCGTTTGTGTACAAGTGCGCCCACCAGAAGCACGAG
TACCTCACCTGCGAGTACGAGGACTACGTGCTCCGCATGAAGGAGTTCGA
GCGGGAGCGCCGGCTGCTGGAGCGCCAGAAGCGCCTCAACAAGGCCGCCT
AGACTTAGGCTAGATAACCCTATACACAAAAAAAAAACACACCCAACACC
ACCAGGCGACGCTCCTGGCCGCGGATTCACTGCCACTGCCCCATGTTGCA
AGCTAGTTTCCAGCGGAAATGTCAATAAACAACTCCATGCTAGTAATAAA
AAAAAAAAAAAAAAAA

LP22717.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:33:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG5548-RA 1071 CG5548-RA 272..820 1..549 2745 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:27:47
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 14954203..14954702 48..547 2500 100 Plus
chrX 22417052 chrX 14954091..14954138 1..48 240 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:59:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:27:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15064049..15064550 48..549 2510 100 Plus
X 23542271 X 15063937..15063984 1..48 240 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15072147..15072648 48..549 2510 100 Plus
X 23527363 X 15072035..15072082 1..48 240 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:27:45 has no hits.

LP22717.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:28:28 Download gff for LP22717.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 14954091..14954137 1..47 100 -> Plus
chrX 14954203..14954702 48..547 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:44:40 Download gff for LP22717.complete
Subject Subject Range Query Range Percent Splice Strand
CG5548-RA 1..354 49..402 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:57:51 Download gff for LP22717.complete
Subject Subject Range Query Range Percent Splice Strand
CG5548-RA 1..354 49..402 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:27:29 Download gff for LP22717.complete
Subject Subject Range Query Range Percent Splice Strand
CG5548-RA 1..354 49..402 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:38:39 Download gff for LP22717.complete
Subject Subject Range Query Range Percent Splice Strand
CG5548-RA 1..354 49..402 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:46:21 Download gff for LP22717.complete
Subject Subject Range Query Range Percent Splice Strand
CG5548-RA 1..354 49..402 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:37:32 Download gff for LP22717.complete
Subject Subject Range Query Range Percent Splice Strand
CG5548-RA 26..572 1..547 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:57:51 Download gff for LP22717.complete
Subject Subject Range Query Range Percent Splice Strand
CG5548-RA 26..572 1..547 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:27:29 Download gff for LP22717.complete
Subject Subject Range Query Range Percent Splice Strand
CG5548-RA 19..565 1..547 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:38:39 Download gff for LP22717.complete
Subject Subject Range Query Range Percent Splice Strand
CG5548-RA 26..572 1..547 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:46:21 Download gff for LP22717.complete
Subject Subject Range Query Range Percent Splice Strand
CG5548-RA 19..565 1..547 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:28 Download gff for LP22717.complete
Subject Subject Range Query Range Percent Splice Strand
X 15063937..15063983 1..47 100 -> Plus
X 15064049..15064548 48..547 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:28 Download gff for LP22717.complete
Subject Subject Range Query Range Percent Splice Strand
X 15063937..15063983 1..47 100 -> Plus
X 15064049..15064548 48..547 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:28:28 Download gff for LP22717.complete
Subject Subject Range Query Range Percent Splice Strand
X 15063937..15063983 1..47 100 -> Plus
X 15064049..15064548 48..547 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:27:29 Download gff for LP22717.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14957970..14958016 1..47 100 -> Plus
arm_X 14958082..14958581 48..547 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:17:17 Download gff for LP22717.complete
Subject Subject Range Query Range Percent Splice Strand
X 15072147..15072646 48..547 100   Plus
X 15072035..15072081 1..47 100 -> Plus

LP22717.pep Sequence

Translation from 48 to 401

> LP22717.pep
MGNALTHYMKPDVMPGPDVVPTFDPLLGFKSRKERVMIATQEEMESAKLP
LEFRDYCAHLAIAYQACRSDTFPFVYKCAHQKHEYLTCEYEDYVLRMKEF
ERERRLLERQKRLNKAA*

LP22717.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:43:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22076-PA 117 GF22076-PA 1..117 1..117 579 91.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:43:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17859-PA 117 GG17859-PA 1..117 1..117 596 94 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:43:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12764-PA 117 GH12764-PA 1..117 1..117 536 82.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
ND-B18-PC 117 CG5548-PC 1..117 1..117 626 100 Plus
ND-B18-PB 117 CG5548-PB 1..117 1..117 626 100 Plus
ND-B18-PA 117 CG5548-PA 1..117 1..117 626 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:43:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15209-PA 117 GI15209-PA 1..117 1..117 499 77.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:43:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26782-PA 117 GL26782-PA 1..117 1..117 547 85.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:43:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18962-PA 117 GA18962-PA 1..117 1..117 551 86.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:43:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17187-PA 119 GD17187-PA 1..117 1..117 611 96.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:43:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16619-PA 117 GJ16619-PA 1..117 1..117 548 84.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:43:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20123-PA 118 GK20123-PA 1..117 1..117 557 88 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:43:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17161-PA 117 GE17161-PA 1..117 1..117 617 98.3 Plus

LP22717.hyp Sequence

Translation from 48 to 401

> LP22717.hyp
MGNALTHYMKPDVMPGPDVVPTFDPLLGFKSRKERVMIATQEEMESAKLP
LEFRDYCAHLAIAYQACRSDTFPFVYKCAHQKHEYLTCEYEDYVLRMKEF
ERERRLLERQKRLNKAA*

LP22717.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG5548-PC 117 CG5548-PC 1..117 1..117 626 100 Plus
CG5548-PB 117 CG5548-PB 1..117 1..117 626 100 Plus
CG5548-PA 117 CG5548-PA 1..117 1..117 626 100 Plus