Clone LP23088 Report

Search the DGRC for LP23088

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:230
Well:88
Vector:pOT2
Associated Gene/TranscriptCG17333-RA
Protein status:LP23088.pep: gold
Sequenced Size:807

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17333 2003-01-01 Sim4 clustering to Release 3
CG17333 2004-03-05 Blastp of sequenced clone
CG17333 2008-04-29 Release 5.5 accounting
CG17333 2008-08-15 Release 5.9 accounting
CG17333 2008-12-18 5.12 accounting

Clone Sequence Records

LP23088.complete Sequence

807 bp (807 high quality bases) assembled on 2004-03-05

GenBank Submission: BT012304

> LP23088.complete
CAATATGTCGGAGAAAAAGGGTGCGCTAAAAGTAATCCCGTCCGCTTCGG
AGGAGCAACTTGTCCAGGCCCTGGGCGATCTTCTCCAGCGCTGCTCCCAG
GAGGCGCTGGCCAAACATGATAAGTTCAGCGTGGGACTTTCGGGTGGTTC
CCTCGTCCAGTTGCTAACGAAAGCCCTGAAATCGTGCAACTTAAAAACGG
CCAAATGGGTGTTTTTCTTCTGTGACGAGCGGTATGTTCGCCTGGATGAC
AGCGATTCCACCTATGGTGCCTACAGGGCCGAGTGGCTAACCCAATTGCC
CTGCATCCAGGAATCCCAGTTCGTCCGCGCCGATACCAGCCAACCGCTGG
ACGCCTGCGCCGCAGATTACGAGGCGAAGGTCAAAAGTCAAGTCGATCGC
TTCGATCTGCTGCTGCTTGGCATGGGACCCGATGGCCACACCTGCTCCCT
CTTTCCCGAGCAGCCAGCCACCCTGCAGGAGACCAAGCGCCTGGTTATCC
CCATCCGGAACTCGCCCAAGCCGCCTCCCGAGCGGATCACTTTCACCCTG
CCGCTGATCAATAAGGCACGGAATGTCGCCTTCGTGGTTACGGGCGCCGC
AAAAGCCAGTGTCGTCAAGAGTGTGTTTGTCGATCTGGACAAGAAGTTTC
CCGCTGCGTGGGTGAATCCGACCAAAGGGCAGTTGACATTGATTGTGGAC
GCGGGTGCTGGAAAAGAAATTGAAACCTTAAAATGACATTCCTTAGTTAA
CTATCGCATCTTGTAAATAATAATTACCTTGATAATCTTAAAAAAAAAAA
AAAAAAA

LP23088.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG17333-RA 1086 CG17333-RA 168..956 1..789 3945 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:04:04
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10739059..10739535 143..619 2385 100 Plus
chrX 22417052 chrX 10739653..10739824 618..789 860 100 Plus
chrX 22417052 chrX 10738786..10738930 1..145 725 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:59:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:04:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10847769..10848245 143..619 2385 100 Plus
X 23542271 X 10848363..10848534 618..789 860 100 Plus
X 23542271 X 10847496..10847640 1..145 725 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:46:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 10855867..10856343 143..619 2385 100 Plus
X 23527363 X 10856461..10856632 618..789 860 100 Plus
X 23527363 X 10855594..10855738 1..145 725 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:04:03 has no hits.

LP23088.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:05:12 Download gff for LP23088.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10738786..10738928 1..143 100 -> Plus
chrX 10739060..10739535 144..619 100 -> Plus
chrX 10739655..10739824 620..789 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:44:45 Download gff for LP23088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17333-RA 1..732 5..736 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:32:00 Download gff for LP23088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17333-RA 1..732 5..736 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:06:01 Download gff for LP23088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17333-RA 1..732 5..736 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:15:50 Download gff for LP23088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17333-RA 1..732 5..736 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:14:35 Download gff for LP23088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17333-RA 1..732 5..736 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:37:00 Download gff for LP23088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17333-RA 1..732 5..736 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:32:00 Download gff for LP23088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17333-RA 1..789 1..789 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:06:01 Download gff for LP23088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17333-RA 59..847 1..789 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:15:50 Download gff for LP23088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17333-RA 1..732 5..736 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:14:35 Download gff for LP23088.complete
Subject Subject Range Query Range Percent Splice Strand
CG17333-RA 59..847 1..789 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:05:12 Download gff for LP23088.complete
Subject Subject Range Query Range Percent Splice Strand
X 10847496..10847638 1..143 100 -> Plus
X 10847770..10848245 144..619 100 -> Plus
X 10848365..10848534 620..789 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:05:12 Download gff for LP23088.complete
Subject Subject Range Query Range Percent Splice Strand
X 10847496..10847638 1..143 100 -> Plus
X 10847770..10848245 144..619 100 -> Plus
X 10848365..10848534 620..789 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:05:12 Download gff for LP23088.complete
Subject Subject Range Query Range Percent Splice Strand
X 10847496..10847638 1..143 100 -> Plus
X 10847770..10848245 144..619 100 -> Plus
X 10848365..10848534 620..789 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:06:01 Download gff for LP23088.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10741529..10741671 1..143 100 -> Plus
arm_X 10741803..10742278 144..619 100 -> Plus
arm_X 10742398..10742567 620..789 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:52:47 Download gff for LP23088.complete
Subject Subject Range Query Range Percent Splice Strand
X 10855868..10856343 144..619 100 -> Plus
X 10856463..10856632 620..789 100   Plus
X 10855594..10855736 1..143 100 -> Plus

LP23088.hyp Sequence

Translation from 0 to 735

> LP23088.hyp
NMSEKKGALKVIPSASEEQLVQALGDLLQRCSQEALAKHDKFSVGLSGGS
LVQLLTKALKSCNLKTAKWVFFFCDERYVRLDDSDSTYGAYRAEWLTQLP
CIQESQFVRADTSQPLDACAADYEAKVKSQVDRFDLLLLGMGPDGHTCSL
FPEQPATLQETKRLVIPIRNSPKPPPERITFTLPLINKARNVAFVVTGAA
KASVVKSVFVDLDKKFPAAWVNPTKGQLTLIVDAGAGKEIETLK*

LP23088.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:43:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG17333-PA 243 CG17333-PA 1..243 2..244 1246 100 Plus

LP23088.pep Sequence

Translation from 4 to 735

> LP23088.pep
MSEKKGALKVIPSASEEQLVQALGDLLQRCSQEALAKHDKFSVGLSGGSL
VQLLTKALKSCNLKTAKWVFFFCDERYVRLDDSDSTYGAYRAEWLTQLPC
IQESQFVRADTSQPLDACAADYEAKVKSQVDRFDLLLLGMGPDGHTCSLF
PEQPATLQETKRLVIPIRNSPKPPPERITFTLPLINKARNVAFVVTGAAK
ASVVKSVFVDLDKKFPAAWVNPTKGQLTLIVDAGAGKEIETLK*

LP23088.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:56:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20427-PA 250 GF20427-PA 1..248 1..242 778 60.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18372-PA 243 GG18372-PA 1..243 1..243 1170 91.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12656-PA 256 GH12656-PA 3..242 2..237 791 62.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG17333-PA 243 CG17333-PA 1..243 1..243 1246 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:56:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14828-PA 1155 GI14828-PA 1..204 1..200 598 58.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:56:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14324-PA 247 GL14324-PA 1..245 1..239 897 69 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14465-PA 247 GA14465-PA 1..245 1..239 890 68.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11437-PA 243 GM11437-PA 1..243 1..243 1251 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24783-PA 153 GD24783-PA 5..153 95..243 590 77.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:56:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19493-PA 250 GJ19493-PA 3..242 2..237 763 60 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:56:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16453-PA 248 GK16453-PA 1..247 1..240 861 64.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:56:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17861-PA 243 GE17861-PA 1..243 1..243 1196 93 Plus