Clone LP23408 Report

Search the DGRC for LP23408

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:234
Well:8
Vector:pOT2
Associated Gene/TranscriptCG14062-RB
Protein status:LP23408.pep: gold
Sequenced Size:1200

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14062 2003-01-01 Sim4 clustering to Release 3
CG14062 2004-03-05 Blastp of sequenced clone
CG14062 2008-04-29 Release 5.5 accounting
CG14062 2008-08-15 Release 5.9 accounting
CG14062 2008-12-18 5.12 accounting

Clone Sequence Records

LP23408.complete Sequence

1200 bp (1200 high quality bases) assembled on 2004-03-05

GenBank Submission: BT012301

> LP23408.complete
GATATGTTGCGAATTCTACTTCTGCTACTGGCATTCTGTGCCTTGGCACA
TGGACAGTGCCGATTCACCAGAGCTCAAGTGCAAGGGACCAATCGGATCT
TTATGGTGCGTGGTCAGAACCGCCAGCTGTCCCTTAAGCGAACAGCCAGT
TCGGCGGTTGGCGAAACCCTGCAGATGTGGTGCAATCCCCGGGACATAGT
GGCCACCACCTGCCAGGCGGGAAGGGTTCCAGCCTTCCAGCCACCCTTGC
CCATGACCTGCCGCGCTGCTCCGGCGGCCATCACCACACCGGTCCAAGAT
CGCAGATGTCCGGCCACCATGTACCGGGTGGGCTACAACGTGGGCAACAA
CCAGTTCCTGGAGCTCTATCGCGCCTGCTTCGATACCAGAGCTGTGAGGG
CTATCTTCGTGGAACACCGGGTGTATGGAAAGCCCTTCTATATCACCCGA
CCCTGTGTCCAATTTAGTTCGGATGGAGTGATCAGTGGCGCGGATGAAGC
TAGCTATACGGTCCGAAATATCCACGGCACCTTTAGGAGGCTGTTTGGCA
ACAATCAGAACTATATACCGAACAACCGCGATGTGATCATCAATCGCGGA
CATCTGGCCGCCTCGGCCGACTTCTTCTTTGGTGACCAATTGTGCGCCAC
CTTCAAGTATGTGAATGCAGTGCCGCAGTTCAAGAGCATCAACGATGGCA
ACTGGGAGACCATCGAGCGATTCGTTCGTAATTCGGTGACCGGAAACAAC
TTTGTGAATGTGCGCACCGGGGCCAGGGGCGTACTCTCGCTGCCATCGGG
CAATAGACCCAAGAATGTCTTCCTAAGTGGCAACAGGAACCCGGTGCCCC
AGTGGATGTACAAGATAGTGCGGAACGCCAACAACCAGCCCATCGTGGCC
TTCCTCACCCTGAACAACATCTACGCACGTCAACGTCCAGCTGCTCCCAA
CTTTTGTCAGCCCGTGAATTGCCCAGTGGCATTGGTCAACACGGCACAGG
CTGGCTTTTCGTTCTGTTGCAACCCCGCCACTTTCAGGCCCTAATTGGAT
GCCTTTCTCAATAAGAAAAACCTGTCAGCCTTACAAAAATGTGAGGTTTT
TAATATAACAAAATTCAAACATGGTAATAATTTAAACAATAATTTAAACT
GAAATTAAAAGTATATTATTTTGGCTTTAGAAAAAAAAAAAAAAAAAAAA

LP23408.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG14062-RB 1276 CG14062-RB 24..1204 1..1181 5905 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24464658..24465398 1180..440 3705 100 Minus
chr3R 27901430 chr3R 24465469..24465862 439..46 1970 100 Minus
chr3R 27901430 chr3R 24465919..24465964 46..1 230 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:59:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 28641584..28642325 1181..440 3710 100 Minus
3R 32079331 3R 28642396..28642789 439..46 1970 100 Minus
3R 32079331 3R 28642846..28642891 46..1 230 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28382415..28383156 1181..440 3710 100 Minus
3R 31820162 3R 28383227..28383620 439..46 1970 100 Minus
3R 31820162 3R 28383677..28383722 46..1 230 100 Minus
Blast to na_te.dros performed 2019-03-15 20:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
412 7567 412 412 7567bp 1357..1445 1085..1166 131 66.3 Plus
Dbif\P-element_M 2935 Dbif\P-element_M P_M 2935bp Derived from X60990. 453..499 1100..1147 120 77.6 Plus

LP23408.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:05:16 Download gff for LP23408.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24464658..24465398 440..1180 100 <- Minus
chr3R 24465469..24465861 47..439 100 <- Minus
chr3R 24465919..24465964 1..46 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:44:48 Download gff for LP23408.complete
Subject Subject Range Query Range Percent Splice Strand
CG14062-RB 1..1041 4..1044 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:39:17 Download gff for LP23408.complete
Subject Subject Range Query Range Percent Splice Strand
CG14062-RB 1..1041 4..1044 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:06:05 Download gff for LP23408.complete
Subject Subject Range Query Range Percent Splice Strand
CG14062-RB 1..1041 4..1044 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:23:01 Download gff for LP23408.complete
Subject Subject Range Query Range Percent Splice Strand
CG14062-RB 1..1041 4..1044 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:14:43 Download gff for LP23408.complete
Subject Subject Range Query Range Percent Splice Strand
CG14062-RB 1..1041 4..1044 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:47:34 Download gff for LP23408.complete
Subject Subject Range Query Range Percent Splice Strand
CG14062-RB 1..1180 1..1180 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:39:17 Download gff for LP23408.complete
Subject Subject Range Query Range Percent Splice Strand
CG14062-RB 1..1180 1..1180 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:06:05 Download gff for LP23408.complete
Subject Subject Range Query Range Percent Splice Strand
CG14062-RB 1..1180 1..1180 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:23:02 Download gff for LP23408.complete
Subject Subject Range Query Range Percent Splice Strand
CG14062-RB 1..1180 1..1180 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:14:43 Download gff for LP23408.complete
Subject Subject Range Query Range Percent Splice Strand
CG14062-RB 1..1180 1..1180 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:05:16 Download gff for LP23408.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28641585..28642325 440..1180 100 <- Minus
3R 28642396..28642788 47..439 100 <- Minus
3R 28642846..28642891 1..46 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:05:16 Download gff for LP23408.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28641585..28642325 440..1180 100 <- Minus
3R 28642396..28642788 47..439 100 <- Minus
3R 28642846..28642891 1..46 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:05:16 Download gff for LP23408.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28641585..28642325 440..1180 100 <- Minus
3R 28642396..28642788 47..439 100 <- Minus
3R 28642846..28642891 1..46 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:06:05 Download gff for LP23408.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24467307..24468047 440..1180 100 <- Minus
arm_3R 24468118..24468510 47..439 100 <- Minus
arm_3R 24468568..24468613 1..46 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:00:29 Download gff for LP23408.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28382416..28383156 440..1180 100 <- Minus
3R 28383227..28383619 47..439 100 <- Minus
3R 28383677..28383722 1..46 100   Minus

LP23408.hyp Sequence

Translation from 0 to 1043

> LP23408.hyp
DMLRILLLLLAFCALAHGQCRFTRAQVQGTNRIFMVRGQNRQLSLKRTAS
SAVGETLQMWCNPRDIVATTCQAGRVPAFQPPLPMTCRAAPAAITTPVQD
RRCPATMYRVGYNVGNNQFLELYRACFDTRAVRAIFVEHRVYGKPFYITR
PCVQFSSDGVISGADEASYTVRNIHGTFRRLFGNNQNYIPNNRDVIINRG
HLAASADFFFGDQLCATFKYVNAVPQFKSINDGNWETIERFVRNSVTGNN
FVNVRTGARGVLSLPSGNRPKNVFLSGNRNPVPQWMYKIVRNANNQPIVA
FLTLNNIYARQRPAAPNFCQPVNCPVALVNTAQAGFSFCCNPATFRP*

LP23408.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG14062-PB 346 CG14062-PB 1..346 2..347 1850 100 Plus
CG12917-PB 356 CG12917-PB 11..354 3..345 692 38.6 Plus
CG33346-PB 364 CG33346-PB 26..345 20..345 534 36.8 Plus
CG9989-PA 370 CG9989-PA 10..358 6..345 304 28 Plus
CG6839-PA 430 CG6839-PA 94..412 54..345 253 24.8 Plus

LP23408.pep Sequence

Translation from 3 to 1043

> LP23408.pep
MLRILLLLLAFCALAHGQCRFTRAQVQGTNRIFMVRGQNRQLSLKRTASS
AVGETLQMWCNPRDIVATTCQAGRVPAFQPPLPMTCRAAPAAITTPVQDR
RCPATMYRVGYNVGNNQFLELYRACFDTRAVRAIFVEHRVYGKPFYITRP
CVQFSSDGVISGADEASYTVRNIHGTFRRLFGNNQNYIPNNRDVIINRGH
LAASADFFFGDQLCATFKYVNAVPQFKSINDGNWETIERFVRNSVTGNNF
VNVRTGARGVLSLPSGNRPKNVFLSGNRNPVPQWMYKIVRNANNQPIVAF
LTLNNIYARQRPAAPNFCQPVNCPVALVNTAQAGFSFCCNPATFRP*

LP23408.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16434-PA 351 GF16434-PA 1..351 1..346 1045 59.1 Plus
Dana\GF12781-PA 348 GF12781-PA 4..346 2..344 754 43.4 Plus
Dana\GF16433-PA 242 GF16433-PA 1..240 106..344 733 55.6 Plus
Dana\GF19869-PA 250 GF19869-PA 1..238 106..344 281 33.5 Plus
Dana\GF23654-PA 429 GF23654-PA 93..411 53..344 248 24.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12061-PA 346 GG12061-PA 1..346 1..346 1715 93.9 Plus
Dere\GG12062-PA 351 GG12062-PA 6..349 1..344 860 50 Plus
Dere\GG24146-PA 351 GG24146-PA 22..349 15..344 740 41.4 Plus
Dere\GG11606-PA 270 GG11606-PA 6..264 2..263 378 36.3 Plus
Dere\GG11608-PA 370 GG11608-PA 7..358 2..344 329 29.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18692-PA 332 GH18692-PA 2..330 21..344 775 47.6 Plus
Dgri\GH18691-PA 332 GH18691-PA 2..330 21..344 759 46.7 Plus
Dgri\GH23404-PA 332 GH23404-PA 2..330 21..344 727 45.8 Plus
Dgri\GH20125-PA 335 GH20125-PA 8..333 17..344 721 41.9 Plus
Dgri\GH23403-PA 342 GH23403-PA 12..340 8..344 694 43.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG14062-PB 346 CG14062-PB 1..346 1..346 1850 100 Plus
CG12917-PB 356 CG12917-PB 11..354 2..344 692 38.6 Plus
CG33346-PB 364 CG33346-PB 26..345 19..344 534 36.8 Plus
Sid-PA 370 CG9989-PA 10..358 5..344 304 28 Plus
CG6839-PA 430 CG6839-PA 94..412 53..344 253 24.8 Plus
CG3819-PB 423 CG3819-PB 150..407 105..345 235 26.7 Plus
CG3819-PA 423 CG3819-PA 150..407 105..345 235 26.7 Plus
CG14120-PA 1371 CG14120-PA 1093..1351 106..344 223 28.4 Plus
CG14120-PA 1371 CG14120-PA 151..406 106..344 213 26 Plus
CG14118-PA 439 CG14118-PA 161..388 99..321 180 26.1 Plus
CG14120-PA 1371 CG14120-PA 790..957 187..344 173 28 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19315-PA 347 GI19315-PA 7..345 4..344 723 41.4 Plus
Dmoj\GI22179-PA 301 GI22179-PA 1..289 58..344 533 40.1 Plus
Dmoj\GI13492-PA 429 GI13492-PA 93..411 53..344 279 26.6 Plus
Dmoj\GI13645-PA 417 GI13645-PA 86..372 53..324 231 26.6 Plus
Dmoj\GI13641-PA 1340 GI13641-PA 1038..1318 86..344 223 27.3 Plus
Dmoj\GI13641-PA 1340 GI13641-PA 80..402 53..344 215 25.7 Plus
Dmoj\GI13641-PA 1340 GI13641-PA 755..922 187..344 205 31 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13695-PA 329 GL13695-PA 16..329 16..346 1092 65.3 Plus
Dper\GL13696-PA 356 GL13696-PA 6..354 1..344 956 52.8 Plus
Dper\GL13697-PA 351 GL13697-PA 6..332 15..340 895 52.4 Plus
Dper\GL11579-PA 371 GL11579-PA 34..369 10..344 716 41.9 Plus
Dper\GL23183-PA 258 GL23183-PA 1..246 106..344 399 38 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12733-PA 346 GA12733-PA 16..346 16..346 1340 74.9 Plus
Dpse\GA26995-PA 356 GA26995-PA 6..354 1..344 968 53.4 Plus
Dpse\GA26996-PB 369 GA26996-PB 10..350 1..340 935 52.3 Plus
Dpse\GA11906-PA 320 GA11906-PA 2..318 26..344 700 42.8 Plus
Dpse\GA27180-PA 258 GA27180-PA 1..246 106..344 407 38.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12290-PA 346 GM12290-PA 1..346 1..346 1784 97.4 Plus
Dsec\GM12291-PA 351 GM12291-PA 6..349 1..344 917 51.2 Plus
Dsec\GM21190-PA 320 GM21190-PA 2..318 26..344 683 40.6 Plus
Dsec\GM12731-PA 357 GM12731-PA 6..345 2..344 543 37 Plus
Dsec\GM12732-PA 370 GM12732-PA 16..358 11..344 269 28.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:35:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18024-PA 346 GD18024-PA 1..346 1..346 1795 98 Plus
Dsim\GD18025-PA 351 GD18025-PA 6..349 1..344 912 50.6 Plus
Dsim\GD10718-PA 325 GD10718-PA 2..323 26..344 698 40.9 Plus
Dsim\GD21377-PA 275 GD21377-PA 6..269 2..268 402 37 Plus
Dsim\GD21378-PA 370 GD21378-PA 16..358 11..344 277 28.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22194-PA 320 GJ22194-PA 2..318 26..344 720 43.8 Plus
Dvir\GJ24298-PA 514 GJ24298-PA 168..502 11..344 645 41.8 Plus
Dvir\GJ11853-PA 428 GJ11853-PA 92..410 53..344 276 26.3 Plus
Dvir\GJ13524-PA 429 GJ13524-PA 156..413 105..345 254 26.7 Plus
Dvir\GJ13976-PA 1389 GJ13976-PA 125..403 84..344 231 25.9 Plus
Dvir\GJ13976-PA 1389 GJ13976-PA 1108..1367 106..344 215 26.1 Plus
Dvir\GJ13976-PA 1389 GJ13976-PA 801..968 187..344 213 32.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10989-PA 349 GK10989-PA 1..349 1..346 1226 67.6 Plus
Dwil\GK10991-PA 350 GK10991-PA 20..348 15..344 941 56 Plus
Dwil\GK18004-PA 321 GK18004-PA 2..319 26..344 699 44.1 Plus
Dwil\GK10992-PA 255 GK10992-PA 1..243 106..344 513 41.9 Plus
Dwil\GK17844-PA 268 GK17844-PA 1..248 106..346 443 42.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10502-PA 346 GE10502-PA 1..346 1..346 1704 92.2 Plus
Dyak\GE10503-PA 351 GE10503-PA 7..349 2..344 883 49.9 Plus
Dyak\GE19342-PA 320 GE19342-PA 2..318 26..344 685 40.9 Plus
Dyak\GE10504-PA 251 GE10504-PA 1..239 106..344 376 37.4 Plus
Dyak\GE23796-PA 373 GE23796-PA 11..361 6..344 312 29.9 Plus