Clone LP23885 Report

Search the DGRC for LP23885

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:238
Well:85
Vector:pOT2
Associated Gene/TranscriptAdk3-RA
Protein status:LP23885.pep: gold
Sequenced Size:1321

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6612 2003-01-01 Sim4 clustering to Release 3
CG6612 2004-07-02 Blastp of sequenced clone
Adk3 2008-04-29 Release 5.5 accounting
Adk3 2008-08-15 Release 5.9 accounting
Adk3 2008-12-18 5.12 accounting

Clone Sequence Records

LP23885.complete Sequence

1321 bp (1321 high quality bases) assembled on 2004-07-02

GenBank Submission: BT015244

> LP23885.complete
AGTTTGTCATTTTTGTATTTCAGATATCAGATTCTGATTTTGCACATGGA
ATGAACTGAAAGTCCAACGCGTAGTGAGAGTGTAAGAGAGCCCCAATAGA
GAGCGCAATATCCCGGAGAGTGTATCCCCCGCCGTGCCCCTTATCAACAC
TTCACGCTGCACTTTCGCAGTGAGAGACGGAGAGTAAGAGAAAAAGTGGT
TAAAGAGGGGACGAACACCCGGCTGTTAGTGTTAGTTGGGGCTCCTAAGA
GAGAGCTAAAGCGAGAGAGACAAGTCTGGAAGCTAAACAACAAGCACCAA
GCAAACACGAAAGATAACGACTTGTTTCATTTGATATTCGCCAGCCGGCA
GAAGCGGAACAAACAAAAAAAAAGAAAAAACAAACTTCGGACGCCGCAGC
TGCGGACACGAAATTAGAATACTTACGGCGACAAGTTATCGCACAAATTA
GTACGCGAACGAGAATTGCTACCGAGATACGTCGGCGGACACCCGAAATT
TTTCCCAAAAACCAAGGTGCCGTCTCAAGGAGAGGTTGAAGAACTAGAGC
TTAGACATGTTTACGAAAATCTTTCGCGCTGTGATAATCGGAGCCCCCGG
CTCGGGCAAAGGAACTATTTCGGAATTGATCTGCAAGAACCATGGATGTG
TGCACATCTCCACGGGGGACATTCTGCGCCAGAACATCATAAAAAACACA
GAACTTGGAAAAAAGGCCAAGCAGTACATTGCTGAAGGTAAACTGGTGCC
CGACGCGATTGTGACCAAGACGATGCTGGCCCGGATAACCGAGGTAGGCA
ACAGGTCGTACATCCTAGACGGATTCCCGCGCAATATAGCCCAGGCCGAG
GCACTGGCTGCACGCGAGCAAATCGATGCCGTGATCACGCTGGACGTTCC
ACATAGTGTGATTATCGACCGGGTCAAGAATCGCTGGATCCATGCGCCCT
CCGGCAGGGTGTACAATATTGGCTTCAAGAATCCCAAAGTGCCTGGCAAA
GATGATGTGACGGGGGAGCCGCTGATGCAACGCGAAGATGATAAACCCCA
TGTGGTGGCCAAGCGACTGGAGCTCTACGATGAGGTGATGAGCCCGGTAA
TAGCCTGGTACGAAAAGAAGGGTCTGGTTGCCACTTTCAAGGGAAAACAG
ACAAAGGAGATCTGGCCGATGATGGAGCTTTTCCTCAACGACCGCATAAA
TGCGTAATGGAGCAACCCCGAAATTACATCCAATGTGCACAAACTAACGA
TAAACTGCTGTGTTCAATTAAGTGCATAATATATTTAGATATATATAAAT
GAAAAAAAAAAAAAAAAAAAA

LP23885.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
Adk3.a 1629 Adk3.a 46..1348 1..1303 6515 100 Plus
Adk3-RA 1631 Adk3-RA 48..1350 1..1303 6515 100 Plus
Adk3.c 1624 Adk3.c 48..1343 1..1303 6385 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:38:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6713103..6713880 1301..524 3890 100 Minus
chr3R 27901430 chr3R 6714603..6715125 523..1 2600 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:59:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10887564..10888343 1303..524 3900 100 Minus
3R 32079331 3R 10889066..10889588 523..1 2615 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10628395..10629174 1303..524 3900 100 Minus
3R 31820162 3R 10629897..10630419 523..1 2615 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:38:16 has no hits.

LP23885.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:39:01 Download gff for LP23885.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6713103..6713880 524..1301 100 <- Minus
chr3R 6714603..6715125 1..523 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:44:57 Download gff for LP23885.complete
Subject Subject Range Query Range Percent Splice Strand
Adk3-RA 1..651 557..1207 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:47:52 Download gff for LP23885.complete
Subject Subject Range Query Range Percent Splice Strand
Adk3-RA 1..651 557..1207 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:15:18 Download gff for LP23885.complete
Subject Subject Range Query Range Percent Splice Strand
Adk3-RA 1..651 557..1207 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:28:59 Download gff for LP23885.complete
Subject Subject Range Query Range Percent Splice Strand
Adk3-RA 1..651 557..1207 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:44:47 Download gff for LP23885.complete
Subject Subject Range Query Range Percent Splice Strand
Adk3-RA 1..651 557..1207 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:57:29 Download gff for LP23885.complete
Subject Subject Range Query Range Percent Splice Strand
Adk3-RA 1..732 476..1207 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:47:51 Download gff for LP23885.complete
Subject Subject Range Query Range Percent Splice Strand
Adk3-RA 1..1301 1..1301 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:15:18 Download gff for LP23885.complete
Subject Subject Range Query Range Percent Splice Strand
Adk3-RA 1..1301 1..1301 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:28:59 Download gff for LP23885.complete
Subject Subject Range Query Range Percent Splice Strand
Adk3-RA 1..732 476..1207 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:44:47 Download gff for LP23885.complete
Subject Subject Range Query Range Percent Splice Strand
Adk3-RA 1..1301 1..1301 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:39:01 Download gff for LP23885.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10887566..10888343 524..1301 100 <- Minus
3R 10889066..10889588 1..523 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:39:01 Download gff for LP23885.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10887566..10888343 524..1301 100 <- Minus
3R 10889066..10889588 1..523 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:39:01 Download gff for LP23885.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10887566..10888343 524..1301 100 <- Minus
3R 10889066..10889588 1..523 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:15:18 Download gff for LP23885.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6713288..6714065 524..1301 100 <- Minus
arm_3R 6714788..6715310 1..523 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:05:51 Download gff for LP23885.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10628397..10629174 524..1301 100 <- Minus
3R 10629897..10630419 1..523 100   Minus

LP23885.pep Sequence

Translation from 556 to 1206

> LP23885.pep
MFTKIFRAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTEL
GKKAKQYIAEGKLVPDAIVTKTMLARITEVGNRSYILDGFPRNIAQAEAL
AAREQIDAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDD
VTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGKQTK
EIWPMMELFLNDRINA*

LP23885.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18267-PA 218 GF18267-PA 1..215 1..215 842 71.2 Plus
Dana\GF12891-PA 240 GF12891-PA 21..209 8..190 363 40.5 Plus
Dana\GF10106-PA 232 GF10106-PA 7..206 6..211 238 29.6 Plus
Dana\GF18220-PA 196 GF18220-PA 11..171 10..191 172 24.6 Plus
Dana\GF24995-PA 223 GF24995-PA 31..147 10..123 145 29.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17252-PA 216 GG17252-PA 1..216 1..216 1059 91.2 Plus
Dere\GG22922-PA 240 GG22922-PA 21..209 8..190 347 38.9 Plus
Dere\GG12202-PA 196 GG12202-PA 11..171 10..191 172 24.6 Plus
Dere\GG13846-PA 219 GG13846-PA 28..187 10..191 151 22.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19429-PA 217 GH19429-PA 1..215 1..215 895 76.3 Plus
Dgri\GH21708-PA 238 GH21708-PA 21..209 8..190 359 40 Plus
Dgri\GH15260-PA 222 GH15260-PA 31..147 10..123 164 31.1 Plus
Dgri\GH18143-PA 197 GH18143-PA 11..129 10..123 158 29.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
Adk3-PD 216 CG6612-PD 1..216 1..216 1119 100 Plus
Adk3-PC 216 CG6612-PC 1..216 1..216 1119 100 Plus
Adk3-PA 216 CG6612-PA 1..216 1..216 1119 100 Plus
Adk3-PB 216 CG6612-PB 1..216 1..216 1119 100 Plus
Adk2-PA 240 CG3140-PA 21..209 8..190 345 39.2 Plus
Adk1-PA 201 CG17146-PA 9..167 10..190 154 23.4 Plus
Adk1-PB 229 CG17146-PB 37..195 10..190 154 23.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22633-PA 217 GI22633-PA 1..215 1..215 916 77.2 Plus
Dmoj\GI12486-PA 224 GI12486-PA 1..203 11..213 530 47.3 Plus
Dmoj\GI20701-PA 240 GI20701-PA 21..209 8..190 377 39.7 Plus
Dmoj\GI11969-PA 225 GI11969-PA 34..193 10..191 190 26.5 Plus
Dmoj\GI22905-PA 197 GI22905-PA 11..171 10..191 182 24.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12056-PA 217 GL12056-PA 1..217 1..216 863 75.1 Plus
Dper\GL11651-PA 222 GL11651-PA 3..191 8..190 371 40.5 Plus
Dper\GL12997-PA 193 GL12997-PA 6..190 3..207 181 23.2 Plus
Dper\GL22014-PA 249 GL22014-PA 64..224 10..191 167 24.1 Plus
Dper\GL25010-PA 225 GL25010-PA 30..193 10..195 162 23.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19723-PA 216 GA19723-PA 1..216 1..216 905 76.9 Plus
Dpse\GA23968-PA 254 GA23968-PA 7..216 6..213 470 44.8 Plus
Dpse\GA16231-PA 240 GA16231-PA 21..209 8..190 369 40.5 Plus
Dpse\GA23172-PA 198 GA23172-PA 6..190 3..207 179 22.7 Plus
Dpse\GA19345-PA 249 GA19345-PA 64..224 10..191 169 24.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26136-PA 216 GM26136-PA 1..216 1..216 1129 98.1 Plus
Dsec\GM18289-PA 240 GM18289-PA 21..209 8..190 359 39.2 Plus
Dsec\GM16084-PA 240 GM16084-PA 21..209 8..190 359 39.2 Plus
Dsec\GM19270-PA 206 GM19270-PA 3..175 25..190 312 39.7 Plus
Dsec\GM10200-PA 253 GM10200-PA 68..228 10..191 170 24.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20690-PA 209 GD20690-PA 1..209 1..216 1060 93.5 Plus
Dsim\GD11825-PA 240 GD11825-PA 21..209 8..190 359 39.2 Plus
Dsim\GD18150-PA 253 GD18150-PA 68..228 10..191 168 24.6 Plus
Dsim\GD12741-PA 206 GD12741-PA 28..187 10..191 156 22.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:45:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23879-PA 217 GJ23879-PA 1..215 1..215 906 76.7 Plus
Dvir\GJ12390-PA 242 GJ12390-PA 14..221 6..213 547 48.6 Plus
Dvir\GJ20444-PA 240 GJ20444-PA 21..209 8..190 364 40.5 Plus
Dvir\GJ23317-PA 197 GJ23317-PA 11..173 10..193 184 24.9 Plus
Dvir\GJ12193-PA 225 GJ12193-PA 34..193 10..191 173 23.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:45:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13283-PA 217 GK13283-PA 1..215 1..215 919 77.7 Plus
Dwil\GK21378-PA 240 GK21378-PA 21..209 8..190 363 38.9 Plus
Dwil\GK12802-PA 196 GK12802-PA 11..173 10..193 178 24.9 Plus
Dwil\GK13248-PA 219 GK13248-PA 30..202 10..211 174 24.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:45:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24653-PA 216 GE24653-PA 1..216 1..216 1060 90.3 Plus
Dyak\GE14359-PA 240 GE14359-PA 21..234 8..213 362 37 Plus
Dyak\GE10646-PA 196 GE10646-PA 11..171 10..191 170 24.6 Plus
Dyak\GE20139-PA 225 GE20139-PA 34..193 10..191 148 22.2 Plus

LP23885.hyp Sequence

Translation from 556 to 1206

> LP23885.hyp
MFTKIFRAVIIGAPGSGKGTISELICKNHGCVHISTGDILRQNIIKNTEL
GKKAKQYIAEGKLVPDAIVTKTMLARITEVGNRSYILDGFPRNIAQAEAL
AAREQIDAVITLDVPHSVIIDRVKNRWIHAPSGRVYNIGFKNPKVPGKDD
VTGEPLMQREDDKPHVVAKRLELYDEVMSPVIAWYEKKGLVATFKGKQTK
EIWPMMELFLNDRINA*

LP23885.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
Adk3-PD 216 CG6612-PD 1..216 1..216 1119 100 Plus
Adk3-PC 216 CG6612-PC 1..216 1..216 1119 100 Plus
Adk3-PA 216 CG6612-PA 1..216 1..216 1119 100 Plus
Adk3-PB 216 CG6612-PB 1..216 1..216 1119 100 Plus
Adk2-PA 240 CG3140-PA 21..209 8..190 345 39.2 Plus