Clone LP24064 Report

Search the DGRC for LP24064

Clone and Library Details

Library:LP
Tissue Source:Drosophila melanogaster larval-early pupal
Created by:Ling Hong
Date Registered:1998-06-11
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:240
Well:64
Vector:pOT2
Associated Gene/TranscriptCG4362-RA
Protein status:LP24064.pep: gold
Sequenced Size:829

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4362 2003-01-01 Sim4 clustering to Release 3
CG4362 2004-01-31 Blastp of sequenced clone
CG4362 2008-04-29 Release 5.5 accounting
CG4362 2008-08-15 Release 5.9 accounting
CG4362 2008-12-18 5.12 accounting

Clone Sequence Records

LP24064.complete Sequence

829 bp (829 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011531

> LP24064.complete
CAAATATACACCATGAAGTACCTGCTCAGCATGACCTTGCTGCTGGCCAT
CGGGCTGCAGCAGATCGACGCCCACGGCATGATGCTGTCCCCGCCGAGCC
GATCCTCCCGTTGGCGCTACGATGGATCCGCACCCCAGAACTGGAACGAC
AACGAACTCTTCTGCGGCGGTTTGTACACGCAGTCCAACAATGGAGGTCG
CTGTGGTCTGTGCGGCGACAACTTCCTGGATGCCCAGCCCCGTGCCAACG
AGATCGGAGGAAGCATCGGTGGAGCTGGTGTGGTGACCAGGAGCTACGTT
GCTGGCAATACCATCACCGTGGGCGTGAAGATCACCACCAATCACTTGGG
TTACTTCGAGTTCCACCTGTGCAACCTGGACGCCTTCGGTGCCGAGTCGG
AGGAGTGCTTCGATCAGAACCGCCTGCGATTCATCGATGGAAGCGATAGA
AAGGATATCGGCGATCAGATGGGCGAATTCGATGTGACAGTCGTCCTGCC
GGAGGGTCTTACCTGCTCTCACTGCGTCCTCCGCTGGACCTATGTGGGTG
CCAACAACTGGGGCATCTGCGATAATTCCGGAAACGGAGCCTTGGGCTGT
GGCCCACAGGAAACATTCAAGAACTGCGCCGATGTGAGCATCTACTGGGG
TCGCAACCTGGTCAAGGAATTGGTCGGTGGCGGAGATCCAGTGGCTCCGG
TTGAGGTCGCCTGAAAATCCAGACTAAAATTCAACGAACTGCCATTTATG
TCTGAAAATGCAAAATGCCAAATAGTCAGCTAAAGTTATTTAAATAAATG
AGTGAACATTTAAAAAAAAAAAAAAAAAA

LP24064.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG4362.a 1184 CG4362.a 127..938 1..812 4045 99.8 Plus
CG4362.b 1875 CG4362.b 1033..1844 1..812 4045 99.8 Plus
CG4362-RA 969 CG4362-RA 127..938 1..812 4045 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:01:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16130502..16130874 550..178 1820 99.2 Minus
chr3R 27901430 chr3R 16130174..16130435 811..550 1310 100 Minus
chr3R 27901430 chr3R 16131301..16131477 177..1 885 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:59:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:01:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20306544..20306916 550..178 1850 99.7 Minus
3R 32079331 3R 20306215..20306477 812..550 1315 100 Minus
3R 32079331 3R 20307343..20307519 177..1 885 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20047375..20047747 550..178 1850 99.7 Minus
3R 31820162 3R 20047046..20047308 812..550 1315 100 Minus
3R 31820162 3R 20048174..20048350 177..1 885 100 Minus
Blast to na_te.dros performed on 2019-03-15 14:01:04 has no hits.

LP24064.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:02:06 Download gff for LP24064.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16130174..16130434 551..811 100 <- Minus
chr3R 16130502..16130874 178..550 99 <- Minus
chr3R 16131301..16131477 1..177 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:45:00 Download gff for LP24064.complete
Subject Subject Range Query Range Percent Splice Strand
CG4362-RA 1..702 13..714 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:40:29 Download gff for LP24064.complete
Subject Subject Range Query Range Percent Splice Strand
CG4362-RA 1..702 13..714 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:14:35 Download gff for LP24064.complete
Subject Subject Range Query Range Percent Splice Strand
CG4362-RA 1..702 13..714 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:29:20 Download gff for LP24064.complete
Subject Subject Range Query Range Percent Splice Strand
CG4362-RA 1..702 13..714 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:46:34 Download gff for LP24064.complete
Subject Subject Range Query Range Percent Splice Strand
CG4362-RA 1..702 13..714 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:49:28 Download gff for LP24064.complete
Subject Subject Range Query Range Percent Splice Strand
CG4362-RA 2..715 1..714 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:40:29 Download gff for LP24064.complete
Subject Subject Range Query Range Percent Splice Strand
CG4362-RA 18..828 1..811 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:14:35 Download gff for LP24064.complete
Subject Subject Range Query Range Percent Splice Strand
CG4362-RA 18..828 1..811 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:29:20 Download gff for LP24064.complete
Subject Subject Range Query Range Percent Splice Strand
CG4362-RA 2..715 1..714 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:46:34 Download gff for LP24064.complete
Subject Subject Range Query Range Percent Splice Strand
CG4362-RA 19..829 1..811 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:02:06 Download gff for LP24064.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20306216..20306476 551..811 100 <- Minus
3R 20306544..20306916 178..550 99 <- Minus
3R 20307343..20307519 1..177 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:02:06 Download gff for LP24064.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20306216..20306476 551..811 100 <- Minus
3R 20306544..20306916 178..550 99 <- Minus
3R 20307343..20307519 1..177 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:02:06 Download gff for LP24064.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20306216..20306476 551..811 100 <- Minus
3R 20306544..20306916 178..550 99 <- Minus
3R 20307343..20307519 1..177 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:14:35 Download gff for LP24064.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16131938..16132198 551..811 100 <- Minus
arm_3R 16132266..16132638 178..550 99 <- Minus
arm_3R 16133065..16133241 1..177 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:01:44 Download gff for LP24064.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20047047..20047307 551..811 100 <- Minus
3R 20047375..20047747 178..550 99 <- Minus
3R 20048174..20048350 1..177 100   Minus

LP24064.hyp Sequence

Translation from 0 to 713

> LP24064.hyp
QIYTMKYLLSMTLLLAIGLQQIDAHGMMLSPPSRSSRWRYDGSAPQNWND
NELFCGGLYTQSNNGGRCGLCGDNFLDAQPRANEIGGSIGGAGVVTRSYV
AGNTITVGVKITTNHLGYFEFHLCNLDAFGAESEECFDQNRLRFIDGSDR
KDIGDQMGEFDVTVVLPEGLTCSHCVLRWTYVGANNWGICDNSGNGALGC
GPQETFKNCADVSIYWGRNLVKELVGGGDPVAPVEVA*

LP24064.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:22:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG4362-PA 233 CG4362-PA 1..233 5..237 1275 100 Plus
CG4367-PB 219 CG4367-PB 9..216 21..237 635 53.2 Plus
CG4367-PA 219 CG4367-PA 9..216 21..237 635 53.2 Plus
CG42598-PB 340 CG42598-PB 7..224 2..214 446 38.2 Plus
CG41284-PC 340 CG41284-PC 7..224 2..214 438 37.8 Plus

LP24064.pep Sequence

Translation from 12 to 713

> LP24064.pep
MKYLLSMTLLLAIGLQQIDAHGMMLSPPSRSSRWRYDGSAPQNWNDNELF
CGGLYTQSNNGGRCGLCGDNFLDAQPRANEIGGSIGGAGVVTRSYVAGNT
ITVGVKITTNHLGYFEFHLCNLDAFGAESEECFDQNRLRFIDGSDRKDIG
DQMGEFDVTVVLPEGLTCSHCVLRWTYVGANNWGICDNSGNGALGCGPQE
TFKNCADVSIYWGRNLVKELVGGGDPVAPVEVA*

LP24064.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17787-PA 233 GF17787-PA 1..233 1..233 1055 83.8 Plus
Dana\GF17331-PA 230 GF17331-PA 3..226 4..232 629 52.1 Plus
Dana\GF21331-PA 234 GF21331-PA 2..182 34..210 380 45 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15554-PA 233 GG15554-PA 1..233 1..233 1141 91.4 Plus
Dere\GG15565-PA 230 GG15565-PA 5..227 2..233 623 51.9 Plus
Dere\GG18746-PA 284 GG18746-PA 31..227 18..210 427 44.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23898-PA 210 GH23898-PA 1..210 1..211 928 81 Plus
Dgri\GH23904-PA 231 GH23904-PA 19..227 17..226 618 53.6 Plus
Dgri\GH19593-PA 370 GH19593-PA 22..218 19..210 450 43.8 Plus
Dgri\GH24606-PA 281 GH24606-PA 34..227 21..210 429 44.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG4362-PA 233 CG4362-PA 1..233 1..233 1275 100 Plus
CG4367-PD 230 CG4367-PD 5..227 2..233 642 50.6 Plus
CG4367-PC 230 CG4367-PC 5..227 2..233 642 50.6 Plus
CG42598-PB 340 CG42598-PB 10..224 1..210 440 38.7 Plus
CG41284-PC 340 CG41284-PC 10..224 1..210 432 38.3 Plus
CG42749-PB 285 CG15786-PA 11..228 1..210 426 43.6 Plus
CG42749-PC 345 CG42749-PC 11..228 1..210 426 43.6 Plus
CG42749-PD 345 CG42749-PD 11..228 1..210 426 43.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10048-PA 245 GI10048-PA 10..225 5..221 667 55 Plus
Dmoj\GI23986-PA 373 GI23986-PA 18..231 3..210 437 40.9 Plus
Dmoj\GI15275-PA 244 GI15275-PA 1..190 25..210 415 45.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12510-PA 235 GL12510-PA 1..219 1..219 1011 84.9 Plus
Dper\GL12511-PA 229 GL12511-PA 4..219 1..217 614 51.8 Plus
Dper\GL12291-PA 365 GL12291-PA 23..223 15..210 449 43.5 Plus
Dper\GL14286-PA 242 GL14286-PA 1..190 25..210 403 43.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18133-PA 235 GA18133-PA 1..219 1..219 1005 84 Plus
Dpse\GA18137-PA 229 GA18137-PA 4..219 1..217 614 51.8 Plus
Dpse\GA18137-PB 212 GA18137-PB 1..202 15..217 603 53.9 Plus
Dpse\GA26262-PB 365 GA26262-PB 23..223 15..210 456 44.4 Plus
Dpse\GA13958-PA 242 GA13958-PA 1..190 25..210 403 43.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23200-PA 233 GM23200-PA 1..233 1..233 1198 95.3 Plus
Dsec\GM12394-PA 285 GM12394-PA 11..228 1..210 432 42.9 Plus
Dsec\GM23202-PA 83 GM23202-PA 5..59 2..56 162 50.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:33:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20074-PA 219 GD20074-PA 7..216 15..233 618 53.6 Plus
Dsim\GD20073-PA 457 GD20073-PA 1..82 1..82 307 72 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:33:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23780-PA 247 GJ23780-PA 1..242 1..232 1012 78.2 Plus
Dvir\GJ23782-PA 235 GJ23782-PA 1..231 1..231 676 54.1 Plus
Dvir\GJ16848-PA 256 GJ16848-PA 3..202 15..210 435 44.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12182-PA 238 GK12182-PA 1..233 1..233 1043 84.1 Plus
Dwil\GK12183-PA 253 GK12183-PA 5..212 1..210 622 53.8 Plus
Dwil\GK12912-PA 379 GK12912-PA 17..231 1..210 468 41.2 Plus
Dwil\GK10292-PA 255 GK10292-PA 7..215 6..210 440 42.4 Plus
Dwil\GK22060-PA 148 GK22060-PA 84..125 168..210 150 58.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25081-PA 233 GE25081-PA 1..233 1..233 1143 91.8 Plus
Dyak\GE25083-PA 230 GE25083-PA 6..227 7..233 613 52.6 Plus
Dyak\GE16388-PA 283 GE16388-PA 30..226 18..210 429 44.4 Plus