Clone MIP01063 Report

Search the DGRC for MIP01063

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:10
Well:63
Vector:pOTB7_DraIII
Associated Gene/TranscriptMtnE-RA
Protein status:MIP01063.pep: gold
Sequenced Size:371

Clone Sequence Records

MIP01063.complete Sequence

371 bp assembled on 2009-04-06

GenBank Submission: BT081974.1

> MIP01063.complete
ATCAGCAAGTTCAACAAGCTTCTAAGACTCGGAATTACTGCAGTAAATAA
ACAAAAAACAAATCAACAAGATGCCTTGCAAGGGATGTGGAAACAACTGC
CAGTGCTCAGCCGGAAAGTGCGGAGGTAACTGCGCCGGAAACAGCCAATG
CCAATGCGCCGCCAAGACGGGAGCCAAGTGCTGCCAGGCCAAGTGATGGC
CGGATCCATTTGGATTAGGTTAAATAGTCTCTAATAGTTGTTACAAACCC
CTGCCTGACGCTGAATAAAACCCATTATAATGTTGTGCTTATCTTAATTT
AATATTACTATTAATTATTGCGAAATGTTGCACTTTAAATCCTTCCAAAA
AAAAAAAAAAAAAAAAAAAAA

MIP01063.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
DMG8-chr3R.29.007.a 701 DMG8-chr3R.29.007.a 261..611 1..351 1725 99.4 Plus
DMG8-chr3R.29.007.b 559 DMG8-chr3R.29.007.b 261..559 1..299 1480 99.6 Plus
MtnB-RA 584 MtnB-RA 212..289 66..143 195 83.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:14:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 16358195..16358443 344..96 1245 100 Minus
chr3R 27901430 chr3R 16358524..16358618 95..1 460 98.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:59:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:14:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20534274..20534529 351..96 1265 99.6 Minus
3R 32079331 3R 20534610..20534704 95..1 460 98.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 20275105..20275360 351..96 1265 99.6 Minus
3R 31820162 3R 20275441..20275535 95..1 460 98.9 Minus
Blast to na_te.dros performed 2019-03-15 17:14:58
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy12 10218 gypsy12 GYPSY12 10218bp 1860..1927 272..339 124 64.7 Plus
gypsy12 10218 gypsy12 GYPSY12 10218bp 9742..9809 272..339 124 64.7 Plus
gypsy4 6852 gypsy4 GYPSY4 6852bp 627..684 42..101 114 70 Plus
Doc2-element 4789 Doc2-element DOC2 4789bp 778..816 28..66 114 76.9 Plus
gypsy5 7369 gypsy5 GYPSY5 7369bp 2210..2257 11..58 105 68.8 Plus

MIP01063.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:15:40 Download gff for MIP01063.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 16358193..16358443 96..346 99 <- Minus
chr3R 16358524..16358618 1..95 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed on 2009-10-19 18:08:47 has no hits.
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:43:57 Download gff for MIP01063.complete
Subject Subject Range Query Range Percent Splice Strand
CG42872-RA 1..126 71..196 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:29:33 Download gff for MIP01063.complete
Subject Subject Range Query Range Percent Splice Strand
MtnE-RA 1..126 71..196 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:30:21 Download gff for MIP01063.complete
Subject Subject Range Query Range Percent Splice Strand
MtnE-RB 1..126 71..196 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed on 2009-04-06 18:09:48 has no hits.
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:43:57 Download gff for MIP01063.complete
Subject Subject Range Query Range Percent Splice Strand
CG42872-RA 1..346 1..346 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:29:33 Download gff for MIP01063.complete
Subject Subject Range Query Range Percent Splice Strand
MtnE-RA 1..346 1..346 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:30:21 Download gff for MIP01063.complete
Subject Subject Range Query Range Percent Splice Strand
MtnE-RB 1..346 1..346 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:15:40 Download gff for MIP01063.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20534279..20534529 96..346 99 <- Minus
3R 20534610..20534704 1..95 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:15:40 Download gff for MIP01063.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20534279..20534529 96..346 99 <- Minus
3R 20534610..20534704 1..95 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:15:40 Download gff for MIP01063.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20534279..20534529 96..346 99 <- Minus
3R 20534610..20534704 1..95 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:29:33 Download gff for MIP01063.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16360332..16360426 1..95 98   Minus
arm_3R 16360001..16360251 96..346 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:19:00 Download gff for MIP01063.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20275110..20275360 96..346 99 <- Minus
3R 20275441..20275535 1..95 98   Minus

MIP01063.hyp Sequence

Translation from 0 to 128

> MIP01063.hyp
ISKFNKLLRLGITAVNKQKTNQQDALQGMWKQLPVLSRKVRR*
Sequence MIP01063.hyp has no blast hits.

MIP01063.pep Sequence

Translation from 70 to 195

> MIP01063.pep
MPCKGCGNNCQCSAGKCGGNCAGNSQCQCAAKTGAKCCQAK*

MIP01063.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
MtnE-PA 41 CG42872-PA 1..41 1..41 250 100 Plus
MtnE-PB 41 CG42872-PB 1..41 1..41 250 100 Plus
MtnB-PC 43 CG4312-PC 1..43 1..41 160 65.1 Plus
MtnB-PB 43 CG4312-PB 1..43 1..41 160 65.1 Plus
MtnB-PA 43 CG4312-PA 1..43 1..41 160 65.1 Plus
MtnD-PB 44 CG33192-PB 1..43 1..41 157 62.8 Plus
MtnC-PA 43 CG5097-PA 1..43 1..41 146 55.8 Plus