MIP01093.complete Sequence
560 bp assembled on 2009-04-06
GenBank Submission: BT081975.1
> MIP01093.complete
ATTTGATTGTTAACACGATGCGATGGCAGTTGGCAATTATGTGGCTTTTC
GCCTCCGCGTTTGCAGTACCTTTCATAAAGTGGCGCCGCCAAATAGTTAC
GCCGAAGCACTTGATGGCACCACCTTTGTCACCCATCGCACAGGACAAGG
TTGTGGTCACCCCGCAGAAGCTTAGAGAAGTGGCTGACTTTAAGGCCATG
ATCCAAAAGGCCGTCGATGAGAACACTTACGTGGTGGCCGCTGCACCATC
AAAGGATTTTCTAGCGACACTGGGTGGAAATTGGGGAGCACCTATATCCT
TGCCTCACTCCTGGACCGCGCCAGCCTTTAATCTTACCTTTTTTTGGCAT
GGATTTGGCTAACAACATGCAAGAAATTTTATCAAATTCGTAGCTCATAC
TCGTAGTAAGTATTAGCATTAGCGATCGAAGAGGTGCGGCAATCGCATAA
GCTTCGAGCCGGGCCTTTTAAGGAACTGCAAGACGAGAGATCAAATGCGA
CCTCTGATTAATAAAGTCAAGCAGTAACTAGCAAAAAAAAAAAAAAAAAA
AAAAAAAAAA
MIP01093.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:29:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17169-RB | 701 | CG17169-RB | 29..558 | 1..530 | 2620 | 99.6 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:32:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrXHet | 204175 | chrXHet | 64132..64409 | 253..530 | 1375 | 99.6 | Plus |
chrXHet | 204175 | chrXHet | 63547..63801 | 1..255 | 1260 | 99.6 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:00:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:32:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 23085257..23085534 | 253..530 | 1375 | 99.6 | Plus |
X | 23542271 | X | 23084672..23084926 | 1..255 | 1260 | 99.6 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 23070349..23070626 | 253..530 | 1375 | 99.6 | Plus |
X | 23527363 | X | 23069764..23070018 | 1..255 | 1260 | 99.6 | Plus |
Blast to na_te.dros performed on 2019-03-16 17:32:52 has no hits.
MIP01093.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:33:47 Download gff for
MIP01093.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrXHet | 64134..64411 | 255..532 | 99 | | Plus |
chrXHet | 63547..63800 | 1..254 | 99 | -> | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed on 2009-10-19 18:08:48 has no hits.
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:43:58 Download gff for
MIP01093.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17169-RB | 1..345 | 18..362 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:35:16 Download gff for
MIP01093.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17169-RB | 1..345 | 18..362 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:01:18 Download gff for
MIP01093.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17169-RB | 1..345 | 18..362 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed on 2009-04-06 18:32:56 has no hits.
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:43:58 Download gff for
MIP01093.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17169-RB | 1..532 | 1..532 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:35:16 Download gff for
MIP01093.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17169-RB | 1..532 | 1..532 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:01:18 Download gff for
MIP01093.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17169-RB | 1..532 | 1..532 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:47 Download gff for
MIP01093.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 23084672..23084925 | 1..254 | 99 | -> | Plus |
X | 23085259..23085536 | 255..532 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:47 Download gff for
MIP01093.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 23084672..23084925 | 1..254 | 99 | -> | Plus |
X | 23085259..23085536 | 255..532 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:47 Download gff for
MIP01093.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 23084672..23084925 | 1..254 | 99 | -> | Plus |
X | 23085259..23085536 | 255..532 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:35:16 Download gff for
MIP01093.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
XHet | 63490..63743 | 1..254 | 99 | -> | Plus |
XHet | 64077..64354 | 255..532 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:19:01 Download gff for
MIP01093.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 23069764..23070017 | 1..254 | 99 | -> | Plus |
X | 23070351..23070628 | 255..532 | 99 | | Plus |
MIP01093.hyp Sequence
Translation from 2 to 361
> MIP01093.hyp
LIVNTMRWQLAIMWLFASAFAVPFIKWRRQIVTPKHLMAPPLSPIAQDKV
VVTPQKLREVADFKAMIQKAVDENTYVVAAAPSKDFLATLGGNWGAPISL
PHSWTAPAFNLTFFWHGFG*
MIP01093.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:54:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17169-PB | 114 | CG17169-PB | 1..114 | 6..119 | 613 | 100 | Plus |
MIP01093.pep Sequence
Translation from 2 to 361
> MIP01093.pep
LIVNTMRWQLAIMWLFASAFAVPFIKWRRQIVTPKHLMAPPLSPIAQDKV
VVTPQKLREVADFKAMIQKAVDENTYVVAAAPSKDFLATLGGNWGAPISL
PHSWTAPAFNLTFFWHGFG*
MIP01093.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:17:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF22146-PA | 108 | GF22146-PA | 1..108 | 6..119 | 246 | 47.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17169-PB | 114 | CG17169-PB | 1..114 | 6..119 | 613 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:17:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI21566-PA | 144 | GI21566-PA | 28..93 | 26..91 | 164 | 58.2 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:17:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA27542-PA | 122 | GA27542-PA | 1..122 | 6..119 | 179 | 38.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:17:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM13281-PA | 87 | GM13281-PA | 1..79 | 6..84 | 369 | 92.4 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:17:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD15470-PA | 163 | GD15470-PA | 1..58 | 38..108 | 222 | 68.1 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:17:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ16692-PA | 150 | GJ16692-PA | 11..92 | 10..91 | 177 | 51.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:17:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE15241-PA | 80 | GE15241-PA | 1..80 | 6..85 | 375 | 88.8 | Plus |