Clone MIP01644 Report

Search the DGRC for MIP01644

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:229
Well:44
Vector:pOT2
Associated Gene/TranscriptCG45076-RE
Protein status:MIP01644.pep: gold
Sequenced Size:1236

Clone Sequence Records

MIP01644.complete Sequence

1236 bp assembled on 2009-01-13

GenBank Submission: BT058020.1

> MIP01644.complete
AGATCAACTCGAACGGGCGTCAAGTGAACAACACGCAACGACGATATATC
CGAACCAAAATCCAACGAACAATTCTATTTGAAAACTCTCAAAGCATCCA
AATCTAAAAATCTCAACATGGTTTACGAAAGTGGATTTACGACCCGCAGA
ACCTACTCCTCGAGGCCGGTGACAACTTCCTACGCAGTTACGTACCCCTC
GGTCGAGAAAGTAACTCGTGTGTACAAGTCGAGTTACCCCATCTACTCGA
GCTACTCGGTGCCACGCCGCGTCTACGGCGCAACCCGGGTGGTGACCTCG
CCCATCCGCGTGGTAACCTCGCCTGCCCGCGTGGTGTCCCGCGTCATACA
CTCACCATCGCCTGTTCGCGTTGTCCGCACGACGACCCGAGTGATTTCAT
CGCCGGAGCGCACCACCTACTCCTACACCACGCCATCGACCTACTACAGC
CCCTCCTACTTGCCATCGACCTACACTTCGACCTACATCCCGACATCGTA
CACCACGTACACGCCGTCCTACGCCTACAGCCCGACCACGGTCACCCGGG
TGTATGCCCCACGCAGTTCGCTGTCGCCGCTGAGGATCACCCCCTCGCCG
GTGAGGGTCATCACCAGCCCGGTTCGCTCTGTGCCCTCCTATCTGAAGAG
GCTGCCGCCTGGTTACGGTGCCCGCGCCCTGACCAATTACCTCAATACCG
AACCCTTTACCACCTTCTCCGAGGAAACAAGCCGGATTCGCAACCGCGCG
CAATCTCTGATTCGTGACTTGCACACTCCCGTGGTGCGCCGTGCACGTAG
CTGCACTCCCTTTCCCGTCACTGGTTACACCTATGAGCCGGCCTCGCAAC
TGGCCCTAGATGCCTATGTGGCCCGTGTCACAAATCCTGTCCGTCATATT
GCCAAGGAAGTTCACAATATTTCGCACTACCCCAGGCCAGCAGTGAAATA
TGTTGGTAAAAGTCATCTTGCATCAGTAAGGATTTGCGGTGACAAGGCCT
ATAATGTTAGAAGTCCGTTGTACGATACGGACAAAGTTCGAACTGATATT
AACCTCTTGTCCTGGTACCTTAGACACCCGACTTGGAAGAATGATAAGAA
ATCCCAAGATCCTGTGAAGGAAGTTGAAGCTGTTGAAGTTGAGGCCTAAA
TGATAACATGCCTGATTTTTGTATGGACATACACTTCTCTTTCTTAAATA
AACCAATCTGAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP01644.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
fau.a 2007 fau.a 351..1563 1..1213 6050 99.9 Plus
fau.f 2931 fau.f 351..1563 1..1213 6050 99.9 Plus
fau.i 2303 fau.i 351..1563 1..1213 6050 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6597633..6598124 711..220 2415 99.4 Minus
chr3R 27901430 chr3R 6602697..6602888 192..1 960 100 Minus
chr3R 27901430 chr3R 6596558..6596726 1123..955 845 100 Minus
chr3R 27901430 chr3R 6596853..6596988 959..824 680 100 Minus
chr3R 27901430 chr3R 6597380..6597492 824..712 565 100 Minus
chr3R 27901430 chr3R 6595867..6595954 1209..1122 440 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:00:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10772113..10772604 711..220 2460 100 Minus
3R 32079331 3R 10777177..10777368 192..1 960 100 Minus
3R 32079331 3R 10771038..10771206 1123..955 845 100 Minus
3R 32079331 3R 10771333..10771468 959..824 680 100 Minus
3R 32079331 3R 10771860..10771972 824..712 565 100 Minus
3R 32079331 3R 10770343..10770434 1213..1122 445 98.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:36:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10512944..10513435 711..220 2460 100 Minus
3R 31820162 3R 10518008..10518199 192..1 960 100 Minus
3R 31820162 3R 10511869..10512037 1123..955 845 100 Minus
3R 31820162 3R 10512164..10512299 959..824 680 100 Minus
3R 31820162 3R 10512691..10512803 824..712 565 100 Minus
3R 31820162 3R 10511174..10511265 1213..1122 445 98.9 Minus
3R 31820162 3R 10513964..10513993 221..192 150 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:10:18 has no hits.

MIP01644.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:11:29 Download gff for MIP01644.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6595866..6595952 1124..1210 98 <- Minus
chr3R 6596558..6596725 956..1123 100 <- Minus
chr3R 6596857..6596987 825..955 100 <- Minus
chr3R 6597380..6597492 712..824 100 <- Minus
chr3R 6597633..6598124 220..711 99 <- Minus
chr3R 6598655..6598681 193..219 100 <- Minus
chr3R 6602697..6602888 1..192 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:59:12 Download gff for MIP01644.complete
Subject Subject Range Query Range Percent Splice Strand
fau-RA 1..838 118..955 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:27:58 Download gff for MIP01644.complete
Subject Subject Range Query Range Percent Splice Strand
fau-RE 1..1032 118..1149 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:46:13 Download gff for MIP01644.complete
Subject Subject Range Query Range Percent Splice Strand
fau-RE 1..1032 118..1149 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:31:49 Download gff for MIP01644.complete
Subject Subject Range Query Range Percent Splice Strand
CG45076-RE 1..1032 118..1149 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-13 11:43:40 Download gff for MIP01644.complete
Subject Subject Range Query Range Percent Splice Strand
fau-RA 1..948 8..955 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:27:58 Download gff for MIP01644.complete
Subject Subject Range Query Range Percent Splice Strand
fau-RE 1..1209 1..1210 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:46:13 Download gff for MIP01644.complete
Subject Subject Range Query Range Percent Splice Strand
fau-RE 7..1215 1..1209 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:31:49 Download gff for MIP01644.complete
Subject Subject Range Query Range Percent Splice Strand
CG45076-RE 7..1215 1..1209 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:11:29 Download gff for MIP01644.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10771337..10771467 825..955 100 <- Minus
3R 10771860..10771972 712..824 100 <- Minus
3R 10771038..10771205 956..1123 100 <- Minus
3R 10772113..10772604 220..711 100 <- Minus
3R 10773135..10773161 193..219 100 <- Minus
3R 10777177..10777368 1..192 100   Minus
3R 10770346..10770432 1124..1210 98 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:11:29 Download gff for MIP01644.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10771337..10771467 825..955 100 <- Minus
3R 10771860..10771972 712..824 100 <- Minus
3R 10771038..10771205 956..1123 100 <- Minus
3R 10772113..10772604 220..711 100 <- Minus
3R 10773135..10773161 193..219 100 <- Minus
3R 10777177..10777368 1..192 100   Minus
3R 10770346..10770432 1124..1210 98 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:11:29 Download gff for MIP01644.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10771337..10771467 825..955 100 <- Minus
3R 10771860..10771972 712..824 100 <- Minus
3R 10771038..10771205 956..1123 100 <- Minus
3R 10772113..10772604 220..711 100 <- Minus
3R 10773135..10773161 193..219 100 <- Minus
3R 10777177..10777368 1..192 100   Minus
3R 10770346..10770432 1124..1210 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:46:13 Download gff for MIP01644.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6596068..6596154 1124..1210 98 <- Minus
arm_3R 6596760..6596927 956..1123 100 <- Minus
arm_3R 6597059..6597189 825..955 100 <- Minus
arm_3R 6597582..6597694 712..824 100 <- Minus
arm_3R 6597835..6598326 220..711 100 <- Minus
arm_3R 6598857..6598883 193..219 100 <- Minus
arm_3R 6602899..6603090 1..192 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:00:40 Download gff for MIP01644.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10512944..10513435 220..711 100 <- Minus
3R 10513966..10513992 193..219 100 <- Minus
3R 10518008..10518199 1..192 100   Minus
3R 10511177..10511263 1124..1210 98 <- Minus
3R 10511869..10512036 956..1123 100 <- Minus
3R 10512168..10512298 825..955 100 <- Minus
3R 10512691..10512803 712..824 100 <- Minus

MIP01644.pep Sequence

Translation from 117 to 1148

> MIP01644.pep
MVYESGFTTRRTYSSRPVTTSYAVTYPSVEKVTRVYKSSYPIYSSYSVPR
RVYGATRVVTSPIRVVTSPARVVSRVIHSPSPVRVVRTTTRVISSPERTT
YSYTTPSTYYSPSYLPSTYTSTYIPTSYTTYTPSYAYSPTTVTRVYAPRS
SLSPLRITPSPVRVITSPVRSVPSYLKRLPPGYGARALTNYLNTEPFTTF
SEETSRIRNRAQSLIRDLHTPVVRRARSCTPFPVTGYTYEPASQLALDAY
VARVTNPVRHIAKEVHNISHYPRPAVKYVGKSHLASVRICGDKAYNVRSP
LYDTDKVRTDINLLSWYLRHPTWKNDKKSQDPVKEVEAVEVEA*

MIP01644.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:13:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17091-PA 851 GF17091-PA 258..513 22..279 882 86.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17266-PA 724 GG17266-PA 132..385 26..279 1282 97.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19567-PA 895 GH19567-PA 258..563 22..329 1186 83.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG45076-PI 343 CG45076-PI 1..343 1..343 1782 100 Plus
CG45076-PE 343 CG45076-PE 1..343 1..343 1782 100 Plus
CG45076-PH 619 CG45076-PH 1..279 1..279 1440 100 Plus
CG45076-PA 619 CG45076-PA 1..279 1..279 1440 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:13:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23863-PA 912 GI23863-PA 258..559 22..330 1098 78.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21932-PA 798 GL21932-PA 244..491 22..279 872 84.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:13:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19674-PB 614 GA19674-PB 1..270 1..280 989 86.1 Plus
Dpse\GA19674-PE 353 GA19674-PE 1..260 1..279 905 83.5 Plus
Dpse\GA19674-PF 827 GA19674-PF 248..482 35..279 825 85.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26150-PA 66 GM26150-PA 1..41 1..41 194 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10576-PA 887 GJ10576-PA 244..559 22..337 1094 75.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13394-PA 891 GK13394-PA 257..564 22..335 1134 80.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\fau-PA 907 GE24668-PA 263..567 26..335 1558 96.8 Plus

MIP01644.hyp Sequence

Translation from 117 to 1148

> MIP01644.hyp
MVYESGFTTRRTYSSRPVTTSYAVTYPSVEKVTRVYKSSYPIYSSYSVPR
RVYGATRVVTSPIRVVTSPARVVSRVIHSPSPVRVVRTTTRVISSPERTT
YSYTTPSTYYSPSYLPSTYTSTYIPTSYTTYTPSYAYSPTTVTRVYAPRS
SLSPLRITPSPVRVITSPVRSVPSYLKRLPPGYGARALTNYLNTEPFTTF
SEETSRIRNRAQSLIRDLHTPVVRRARSCTPFPVTGYTYEPASQLALDAY
VARVTNPVRHIAKEVHNISHYPRPAVKYVGKSHLASVRICGDKAYNVRSP
LYDTDKVRTDINLLSWYLRHPTWKNDKKSQDPVKEVEAVEVEA*

MIP01644.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:40:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG45076-PI 343 CG45076-PI 1..343 1..343 1782 100 Plus
CG45076-PE 343 CG45076-PE 1..343 1..343 1782 100 Plus
CG45076-PH 619 CG45076-PH 1..279 1..279 1440 100 Plus
CG45076-PA 619 CG45076-PA 1..279 1..279 1440 100 Plus