Clone MIP01986 Report

Search the DGRC for MIP01986

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:232
Well:86
Vector:pOT2
Associated Gene/TranscriptCG15120-RA
Protein status:MIP01986.pep: gold
Sequenced Size:1094

Clone Sequence Records

MIP01986.complete Sequence

1094 bp assembled on 2009-02-19

GenBank Submission: BT060445.1

> MIP01986.complete
GTTCGCTGTTTACACTACGTGGCTGCACATCGTCGCATCAACCGGAAATG
GCCATGGCCCAAACGGCACGCACCGCGACGGCAAGGCGTCCCACGCACGA
CTACCACAGGCCGACGCGCTCCAAGTCCGCCAATCCGGCGCAACTGCGTC
CACTTAGCGGCATCCATGGAGCGGCGGTCTCGTCGCGTCCGCGCTACGTT
CCACCCTTCTCCATTCAGTCGCAGCAAAAGAACACGGTCGTCATCGACGG
ACCCATCCACGAAACCGCCCCCAAGACAGCCAGTGCCAGGAGTCGGGTGC
CCAATCCGAAAATTCTGAGGCGCCAACAAAAGTCCATGTCCACCTTCAAC
TTGGGCATGGGTCTTAATGGCTGCTCCACCGGTGGGGCTAATGATCCGGG
ACGAGGAACCCTCTTCCGAATGTACTTTGACCGCGGCGACCTGCCCATAA
AGATGGAGTACCTCTGCGGGGGCGACAAAATCGGATGGACGGTGGACATT
GAAAAGCTGGACTACAGCCTCTATCTGCCGCTCTTCTTCGACGGACTGGC
GGAGACGAAACATCCCTACAAGACCTATGCCCGCCAGGGGGTCACGGATC
TCCTCTTGGCCGGGGGCGAGAAGATACACCCGGTGATACCGCAATTAATA
TTGCCGCTGAAGAACGCATTGAGCACACGAAACCTGGAGGTAATGTGCAC
GACATTGAAGATAATCCAACAGCTGGTCATGTCCTCGGATTTGGTGGGAC
CCGCCCTGGTGCCCTTCTACCGCCAGTTGCTGCCCATGTTCAATGCATTT
AAGGTGAAAAACTTAAACTGCGGCGATGAGATCGACTATGCCCAGAAGAA
CAATCTGAATCTGGGGGATCTGATCGATGAGACGCTGCAGGTGCTGGAAC
TGCATGGCGGCGAGGATGCCTTCATCAACATCAAGTACATGGTGCCGACT
TACGAGTCCTGCTATTTAAATTAAACTACGCCTCATGGTCTTGTCCCTTT
ACATACAATATCATAAGTATTTATTGAATTTTACAAAACATTACAGCATT
AAATAGATATTTGTTACAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP01986.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG15120-RA 1069 CG15120-RA 2..1068 1..1067 5320 99.9 Plus
CG16926-RA 1115 CG16926-RA 997..1115 1071..953 580 99.1 Minus
CG17349-RA 1225 CG17349-RA 944..984 916..956 175 95.1 Plus
CG17349-RA 1225 CG17349-RA 787..828 753..794 150 90.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:49:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15384944..15385255 1..312 1530 99.4 Plus
chr2R 21145070 chr2R 15387308..15387561 814..1067 1225 98.8 Plus
chr2R 21145070 chr2R 15386807..15386979 491..663 865 100 Plus
chr2R 21145070 chr2R 15385349..15385530 313..494 820 96.7 Plus
chr2R 21145070 chr2R 15387090..15387239 664..813 735 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:00:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19497755..19498066 1..312 1560 100 Plus
2R 25286936 2R 19500119..19500376 814..1071 1260 99.2 Plus
2R 25286936 2R 19498160..19498341 313..494 910 100 Plus
2R 25286936 2R 19499618..19499790 491..663 865 100 Plus
2R 25286936 2R 19499901..19500050 664..813 750 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19498954..19499265 1..312 1560 100 Plus
2R 25260384 2R 19501318..19501575 814..1071 1260 99.2 Plus
2R 25260384 2R 19499359..19499540 313..494 910 100 Plus
2R 25260384 2R 19500817..19500989 491..663 865 100 Plus
2R 25260384 2R 19501100..19501249 664..813 750 100 Plus
2L 23513712 2L 19372476..19372516 916..956 175 95.1 Plus
2L 23513712 2L 19372319..19372360 753..794 150 90.4 Plus
Blast to na_te.dros performed on 2019-03-15 20:49:30 has no hits.

MIP01986.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:50:35 Download gff for MIP01986.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15385349..15385527 313..491 96 -> Plus
chr2R 15386808..15386979 492..663 100 -> Plus
chr2R 15387090..15387239 664..813 99 -> Plus
chr2R 15387308..15387561 814..1067 98   Plus
chr2R 15384944..15385255 1..312 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:02 Download gff for MIP01986.complete
Subject Subject Range Query Range Percent Splice Strand
CG15120-RA 1..927 48..974 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:36:24 Download gff for MIP01986.complete
Subject Subject Range Query Range Percent Splice Strand
CG15120-RA 1..927 48..974 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:24:06 Download gff for MIP01986.complete
Subject Subject Range Query Range Percent Splice Strand
CG15120-RA 1..927 48..974 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:31:28 Download gff for MIP01986.complete
Subject Subject Range Query Range Percent Splice Strand
CG15120-RA 1..927 48..974 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-19 18:55:53 Download gff for MIP01986.complete
Subject Subject Range Query Range Percent Splice Strand
CG15120-RA 2..1068 1..1067 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:36:24 Download gff for MIP01986.complete
Subject Subject Range Query Range Percent Splice Strand
CG15120-RA 2..1068 1..1067 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:24:06 Download gff for MIP01986.complete
Subject Subject Range Query Range Percent Splice Strand
CG15120-RA 4..1070 1..1067 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:31:28 Download gff for MIP01986.complete
Subject Subject Range Query Range Percent Splice Strand
CG15120-RA 4..1070 1..1067 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:50:35 Download gff for MIP01986.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19497755..19498066 1..312 100 -> Plus
2R 19498160..19498338 313..491 100 -> Plus
2R 19499619..19499790 492..663 100 -> Plus
2R 19499901..19500050 664..813 100 -> Plus
2R 19500119..19500372 814..1067 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:50:35 Download gff for MIP01986.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19497755..19498066 1..312 100 -> Plus
2R 19498160..19498338 313..491 100 -> Plus
2R 19499619..19499790 492..663 100 -> Plus
2R 19499901..19500050 664..813 100 -> Plus
2R 19500119..19500372 814..1067 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:50:35 Download gff for MIP01986.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19497755..19498066 1..312 100 -> Plus
2R 19498160..19498338 313..491 100 -> Plus
2R 19499619..19499790 492..663 100 -> Plus
2R 19499901..19500050 664..813 100 -> Plus
2R 19500119..19500372 814..1067 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:24:06 Download gff for MIP01986.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15385260..15385571 1..312 100 -> Plus
arm_2R 15385665..15385843 313..491 100 -> Plus
arm_2R 15387124..15387295 492..663 100 -> Plus
arm_2R 15387406..15387555 664..813 100 -> Plus
arm_2R 15387624..15387877 814..1067 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:10:00 Download gff for MIP01986.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19498954..19499265 1..312 100 -> Plus
2R 19499359..19499537 313..491 100 -> Plus
2R 19500818..19500989 492..663 100 -> Plus
2R 19501100..19501249 664..813 100 -> Plus
2R 19501318..19501571 814..1067 99   Plus

MIP01986.hyp Sequence

Translation from 2 to 973

> MIP01986.hyp
SLFTLRGCTSSHQPEMAMAQTARTATARRPTHDYHRPTRSKSANPAQLRP
LSGIHGAAVSSRPRYVPPFSIQSQQKNTVVIDGPIHETAPKTASARSRVP
NPKILRRQQKSMSTFNLGMGLNGCSTGGANDPGRGTLFRMYFDRGDLPIK
MEYLCGGDKIGWTVDIEKLDYSLYLPLFFDGLAETKHPYKTYARQGVTDL
LLAGGEKIHPVIPQLILPLKNALSTRNLEVMCTTLKIIQQLVMSSDLVGP
ALVPFYRQLLPMFNAFKVKNLNCGDEIDYAQKNNLNLGDLIDETLQVLEL
HGGEDAFINIKYMVPTYESCYLN*

MIP01986.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG15120-PA 308 CG15120-PA 1..308 16..323 1617 100 Plus
CG17349-PA 266 CG17349-PA 32..252 64..319 415 38.9 Plus

MIP01986.pep Sequence

Translation from 2 to 973

> MIP01986.pep
SLFTLRGCTSSHQPEMAMAQTARTATARRPTHDYHRPTRSKSANPAQLRP
LSGIHGAAVSSRPRYVPPFSIQSQQKNTVVIDGPIHETAPKTASARSRVP
NPKILRRQQKSMSTFNLGMGLNGCSTGGANDPGRGTLFRMYFDRGDLPIK
MEYLCGGDKIGWTVDIEKLDYSLYLPLFFDGLAETKHPYKTYARQGVTDL
LLAGGEKIHPVIPQLILPLKNALSTRNLEVMCTTLKIIQQLVMSSDLVGP
ALVPFYRQLLPMFNAFKVKNLNCGDEIDYAQKNNLNLGDLIDETLQVLEL
HGGEDAFINIKYMVPTYESCYLN*

MIP01986.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11719-PA 310 GF11719-PA 1..310 18..323 1511 91.9 Plus
Dana\GF14715-PA 266 GF14715-PA 61..252 132..319 409 43.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21981-PA 308 GG21981-PA 1..308 16..323 1646 99.4 Plus
Dere\GG21171-PA 266 GG21171-PA 32..252 64..319 423 38.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23003-PA 308 GH23003-PA 8..308 24..323 1325 83 Plus
Dgri\GH13446-PA 274 GH13446-PA 65..256 132..319 402 42.3 Plus
Dgri\GH12932-PA 274 GH12932-PA 65..256 132..319 402 42.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG15120-PA 308 CG15120-PA 1..308 16..323 1617 100 Plus
CG17349-PA 266 CG17349-PA 32..252 64..319 415 38.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18969-PA 305 GI18969-PA 8..305 24..323 1303 81.6 Plus
Dmoj\GI14007-PA 274 GI14007-PA 65..256 132..319 400 42.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21291-PA 312 GL21291-PA 1..312 18..323 1392 85.8 Plus
Dper\GL21201-PA 264 GL21201-PA 27..252 60..319 423 38.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13509-PA 312 GA13509-PA 1..312 18..323 1394 86.1 Plus
Dpse\GA14474-PA 264 GA14474-PA 27..252 60..319 420 38.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21969-PA 308 GM21969-PA 1..308 16..323 1649 99.7 Plus
Dsec\GM17338-PA 266 GM17338-PA 32..252 64..319 422 38.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11462-PA 109 GD11462-PA 1..109 215..323 569 98.2 Plus
Dsim\GD24196-PA 266 GD24196-PA 32..252 64..319 422 38.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20913-PA 305 GJ20913-PA 8..305 24..323 1324 83.3 Plus
Dvir\GJ18253-PA 274 GJ18253-PA 65..256 132..319 402 43.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15876-PA 310 GK15876-PA 5..310 19..323 1341 83.7 Plus
Dwil\GK23829-PA 266 GK23829-PA 61..252 132..319 405 42.8 Plus
Dwil\GK18613-PA 87 GK18613-PA 24..86 105..167 277 77.8 Plus
Dwil\GK24043-PA 412 GK24043-PA 328..411 84..167 275 64.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12060-PA 308 GE12060-PA 1..308 16..323 1646 99.4 Plus
Dyak\GE13244-PA 266 GE13244-PA 32..252 64..319 423 38.9 Plus