Clone MIP02714 Report

Search the DGRC for MIP02714

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:27
Well:14
Vector:pOT2
Associated Gene/TranscriptCG9029-RA
Protein status:MIP02714.pep: gold
Sequenced Size:561

Clone Sequence Records

MIP02714.complete Sequence

561 bp assembled on 2009-10-30

GenBank Submission: BT100182.1

> MIP02714.complete
GATCATGAAATTCTTGACCGTATTTGCATTCGCCTGTGTGGCAACATTTG
TGGTGCTCCACGGCGCCTACGGCTCACCACTGCCGGAGCCCATTCCCGAT
CCGAGTCCGGTGGCCGATCCGAGTCCGGCTGCCAATCCCAGTCCAGTTGC
CGATCCGAAGCCCGTTGCCGAGCCATCTGCCAATCCAGGGACCGGAACCA
ACGCAGAACCAGGTCCGAGGAGCAAACCGAATCCCAGTCCCTCGGCACCA
GCAACTCTTTTGGAAGCCAATAAGCAAGACAACTTTGCGGTTCCGCTCCT
AGAAACTGCTCCGCAAAAGCTGGATGATGTTCAGGCCGATCCCCAGCCGG
CTTAGTGGGTGCATGACCCCACATCAAGGAGCAGCAGCAGCAGCTTAATC
CAACTGGAGCCTGCACACCCACACACAAGGGAGACACGCACACATATATA
TATTAATCTTCTGTATTCAATGTATGCATTTATGTATTCCAACTTCTAGC
ATGGGCATTAATAAAATTGCAAAAAAAATAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAA

MIP02714.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:40:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG9029-RA 670 CG9029-RA 34..563 1..530 2650 100 Plus
CG9029.a 585 CG9029.a 87..579 38..530 2465 100 Plus
CG9029.a 585 CG9029.a 32..69 1..38 190 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:07:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5885169..5885660 38..529 2460 100 Plus
chr2L 23010047 chr2L 5885067..5885104 1..38 190 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:00:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5886118..5886610 38..530 2465 100 Plus
3L 28110227 3L 24278331..24278386 506..561 205 91.1 Plus
2L 23513712 2L 5886016..5886053 1..38 190 100 Plus
3L 28110227 3L 22809951..22810003 506..558 190 90.6 Plus
3L 28110227 3L 23378391..23378443 506..558 190 90.6 Plus
3L 28110227 3L 23386557..23386607 556..506 180 90.2 Minus
3R 32079331 3R 18039016..18039066 506..556 180 90.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:38:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5886118..5886610 38..530 2465 100 Plus
3L 28103327 3L 24271431..24271486 506..561 205 91 Plus
2L 23513712 2L 5886016..5886053 1..38 190 100 Plus
3L 28103327 3L 23371491..23371543 506..558 190 90.5 Plus
3L 28103327 3L 22803051..22803103 506..558 190 90.5 Plus
Blast to na_te.dros performed on 2019-03-16 02:07:03 has no hits.

MIP02714.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:07:44 Download gff for MIP02714.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5885067..5885104 1..38 100 -> Plus
chr2L 5885170..5885660 39..529 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-30 14:14:15 Download gff for MIP02714.complete
Subject Subject Range Query Range Percent Splice Strand
CG9029-RA 1..351 5..355 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:14:46 Download gff for MIP02714.complete
Subject Subject Range Query Range Percent Splice Strand
CG9029-RA 1..351 5..355 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:15:30 Download gff for MIP02714.complete
Subject Subject Range Query Range Percent Splice Strand
CG9029-RA 1..351 5..355 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:58:27 Download gff for MIP02714.complete
Subject Subject Range Query Range Percent Splice Strand
CG9029-RA 1..351 5..355 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-30 14:14:13 Download gff for MIP02714.complete
Subject Subject Range Query Range Percent Splice Strand
CG9029-RA 1..525 5..529 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:14:46 Download gff for MIP02714.complete
Subject Subject Range Query Range Percent Splice Strand
CG9029-RA 1..525 5..529 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:15:30 Download gff for MIP02714.complete
Subject Subject Range Query Range Percent Splice Strand
CG9029-RA 15..543 1..529 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:58:27 Download gff for MIP02714.complete
Subject Subject Range Query Range Percent Splice Strand
CG9029-RA 15..543 1..529 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:44 Download gff for MIP02714.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5886016..5886053 1..38 100 -> Plus
2L 5886119..5886609 39..529 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:44 Download gff for MIP02714.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5886016..5886053 1..38 100 -> Plus
2L 5886119..5886609 39..529 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:44 Download gff for MIP02714.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5886016..5886053 1..38 100 -> Plus
2L 5886119..5886609 39..529 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:15:30 Download gff for MIP02714.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5886016..5886053 1..38 100 -> Plus
arm_2L 5886119..5886609 39..529 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:05:02 Download gff for MIP02714.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5886119..5886609 39..529 100   Plus
2L 5886016..5886053 1..38 100 -> Plus

MIP02714.hyp Sequence

Translation from 0 to 354

> MIP02714.hyp
IMKFLTVFAFACVATFVVLHGAYGSPLPEPIPDPSPVADPSPAANPSPVA
DPKPVAEPSANPGTGTNAEPGPRSKPNPSPSAPATLLEANKQDNFAVPLL
ETAPQKLDDVQADPQPA*

MIP02714.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:39:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG9029-PA 116 CG9029-PA 1..116 2..117 616 100 Plus
CG9029-PB 122 CG9029-PB 1..122 2..117 599 95.1 Plus

MIP02714.pep Sequence

Translation from 1 to 354

> MIP02714.pep
IMKFLTVFAFACVATFVVLHGAYGSPLPEPIPDPSPVADPSPAANPSPVA
DPKPVAEPSANPGTGTNAEPGPRSKPNPSPSAPATLLEANKQDNFAVPLL
ETAPQKLDDVQADPQPA*

MIP02714.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:46:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15586-PA 112 GF15586-PA 1..47 2..48 191 76.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:46:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25101-PA 100 GG25101-PA 1..69 2..70 217 70.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG9029-PA 116 CG9029-PA 1..116 2..117 616 100 Plus
CG9029-PB 122 CG9029-PB 1..122 2..117 599 95.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19041-PA 190 GL19041-PA 1..47 2..42 139 63.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25321-PA 184 GA25321-PA 1..41 2..42 157 73.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18577-PA 118 GM18577-PA 1..118 2..117 491 89 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23367-PA 118 GD23367-PA 1..118 2..117 475 85.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25701-PA 114 GE25701-PA 1..114 2..117 241 58.2 Plus