MIP02714.complete Sequence
561 bp assembled on 2009-10-30
GenBank Submission: BT100182.1
> MIP02714.complete
GATCATGAAATTCTTGACCGTATTTGCATTCGCCTGTGTGGCAACATTTG
TGGTGCTCCACGGCGCCTACGGCTCACCACTGCCGGAGCCCATTCCCGAT
CCGAGTCCGGTGGCCGATCCGAGTCCGGCTGCCAATCCCAGTCCAGTTGC
CGATCCGAAGCCCGTTGCCGAGCCATCTGCCAATCCAGGGACCGGAACCA
ACGCAGAACCAGGTCCGAGGAGCAAACCGAATCCCAGTCCCTCGGCACCA
GCAACTCTTTTGGAAGCCAATAAGCAAGACAACTTTGCGGTTCCGCTCCT
AGAAACTGCTCCGCAAAAGCTGGATGATGTTCAGGCCGATCCCCAGCCGG
CTTAGTGGGTGCATGACCCCACATCAAGGAGCAGCAGCAGCAGCTTAATC
CAACTGGAGCCTGCACACCCACACACAAGGGAGACACGCACACATATATA
TATTAATCTTCTGTATTCAATGTATGCATTTATGTATTCCAACTTCTAGC
ATGGGCATTAATAAAATTGCAAAAAAAATAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAA
MIP02714.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:40:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9029-RA | 670 | CG9029-RA | 34..563 | 1..530 | 2650 | 100 | Plus |
CG9029.a | 585 | CG9029.a | 87..579 | 38..530 | 2465 | 100 | Plus |
CG9029.a | 585 | CG9029.a | 32..69 | 1..38 | 190 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:07:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 5885169..5885660 | 38..529 | 2460 | 100 | Plus |
chr2L | 23010047 | chr2L | 5885067..5885104 | 1..38 | 190 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:00:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5886118..5886610 | 38..530 | 2465 | 100 | Plus |
3L | 28110227 | 3L | 24278331..24278386 | 506..561 | 205 | 91.1 | Plus |
2L | 23513712 | 2L | 5886016..5886053 | 1..38 | 190 | 100 | Plus |
3L | 28110227 | 3L | 22809951..22810003 | 506..558 | 190 | 90.6 | Plus |
3L | 28110227 | 3L | 23378391..23378443 | 506..558 | 190 | 90.6 | Plus |
3L | 28110227 | 3L | 23386557..23386607 | 556..506 | 180 | 90.2 | Minus |
3R | 32079331 | 3R | 18039016..18039066 | 506..556 | 180 | 90.2 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:38:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5886118..5886610 | 38..530 | 2465 | 100 | Plus |
3L | 28103327 | 3L | 24271431..24271486 | 506..561 | 205 | 91 | Plus |
2L | 23513712 | 2L | 5886016..5886053 | 1..38 | 190 | 100 | Plus |
3L | 28103327 | 3L | 23371491..23371543 | 506..558 | 190 | 90.5 | Plus |
3L | 28103327 | 3L | 22803051..22803103 | 506..558 | 190 | 90.5 | Plus |
Blast to na_te.dros performed on 2019-03-16 02:07:03 has no hits.
MIP02714.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:07:44 Download gff for
MIP02714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 5885067..5885104 | 1..38 | 100 | -> | Plus |
chr2L | 5885170..5885660 | 39..529 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-30 14:14:15 Download gff for
MIP02714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9029-RA | 1..351 | 5..355 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:14:46 Download gff for
MIP02714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9029-RA | 1..351 | 5..355 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:15:30 Download gff for
MIP02714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9029-RA | 1..351 | 5..355 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:58:27 Download gff for
MIP02714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9029-RA | 1..351 | 5..355 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-30 14:14:13 Download gff for
MIP02714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9029-RA | 1..525 | 5..529 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:14:46 Download gff for
MIP02714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9029-RA | 1..525 | 5..529 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:15:30 Download gff for
MIP02714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9029-RA | 15..543 | 1..529 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:58:27 Download gff for
MIP02714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9029-RA | 15..543 | 1..529 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:44 Download gff for
MIP02714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5886016..5886053 | 1..38 | 100 | -> | Plus |
2L | 5886119..5886609 | 39..529 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:44 Download gff for
MIP02714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5886016..5886053 | 1..38 | 100 | -> | Plus |
2L | 5886119..5886609 | 39..529 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:07:44 Download gff for
MIP02714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5886016..5886053 | 1..38 | 100 | -> | Plus |
2L | 5886119..5886609 | 39..529 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:15:30 Download gff for
MIP02714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 5886016..5886053 | 1..38 | 100 | -> | Plus |
arm_2L | 5886119..5886609 | 39..529 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:05:02 Download gff for
MIP02714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5886119..5886609 | 39..529 | 100 | | Plus |
2L | 5886016..5886053 | 1..38 | 100 | -> | Plus |
MIP02714.hyp Sequence
Translation from 0 to 354
> MIP02714.hyp
IMKFLTVFAFACVATFVVLHGAYGSPLPEPIPDPSPVADPSPAANPSPVA
DPKPVAEPSANPGTGTNAEPGPRSKPNPSPSAPATLLEANKQDNFAVPLL
ETAPQKLDDVQADPQPA*
MIP02714.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:39:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9029-PA | 116 | CG9029-PA | 1..116 | 2..117 | 616 | 100 | Plus |
CG9029-PB | 122 | CG9029-PB | 1..122 | 2..117 | 599 | 95.1 | Plus |
MIP02714.pep Sequence
Translation from 1 to 354
> MIP02714.pep
IMKFLTVFAFACVATFVVLHGAYGSPLPEPIPDPSPVADPSPAANPSPVA
DPKPVAEPSANPGTGTNAEPGPRSKPNPSPSAPATLLEANKQDNFAVPLL
ETAPQKLDDVQADPQPA*
MIP02714.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:46:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF15586-PA | 112 | GF15586-PA | 1..47 | 2..48 | 191 | 76.6 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:46:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG25101-PA | 100 | GG25101-PA | 1..69 | 2..70 | 217 | 70.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9029-PA | 116 | CG9029-PA | 1..116 | 2..117 | 616 | 100 | Plus |
CG9029-PB | 122 | CG9029-PB | 1..122 | 2..117 | 599 | 95.1 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:46:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL19041-PA | 190 | GL19041-PA | 1..47 | 2..42 | 139 | 63.8 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:46:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA25321-PA | 184 | GA25321-PA | 1..41 | 2..42 | 157 | 73.2 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:46:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18577-PA | 118 | GM18577-PA | 1..118 | 2..117 | 491 | 89 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:46:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23367-PA | 118 | GD23367-PA | 1..118 | 2..117 | 475 | 85.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:46:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE25701-PA | 114 | GE25701-PA | 1..114 | 2..117 | 241 | 58.2 | Plus |