Clone MIP02909 Report

Search the DGRC for MIP02909

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:29
Well:9
Vector:pOT2
Associated Gene/TranscriptFer1HCH-RF
Protein status:MIP02909.pep: gold
Sequenced Size:998

Clone Sequence Records

MIP02909.complete Sequence

998 bp assembled on 2009-01-12

GenBank Submission: BT056297.1

> MIP02909.complete
AATCAAACTAAAGTGAAAAACAAATTTTTGTTCTGTGATTTTGTGTAAAG
ACTACGTTCGACGATCAAAGATGGTGAAACTAATTGCTAGCCTGCTCCTG
TTGGCCGTGGTGGCCCAGGCCTATGGAGATTTCAAGTCCAAGCAAGAAAG
CAAGAGTTTCGTGAGAGAGCTTCAAAGGGAGCGAGAAGAGCATCAACTAA
AAGAAAAACAAAACCTAAGCCATGAAGGTCAAGACCAAGAGTGCAAAGGC
TCCCTGGCTGTTCCTGAGATTACCAAGGACTGGGTGGACATGAAGGATGC
CTGCATAAAGGGCATGCGCAATCAGATCCAGGAGGAGATCAACGCCTCCT
ACCAGTACTTGGCCATGGGCGCCTACTTCTCCCGCGACACCGTCAACCGC
CCTGGATTCGCCGAGCACTTCTTCAAGGCCGCCAAGGAGGAACGTGAGCA
CGGATCCAAGCTGGTGGAGTACCTGTCCATGCGCGGTCAACTGACCGAGG
GAGTCAGCGATCTGATCAATGTGCCGACTGTGGCCAAGCAGGAGTGGACC
GATGGTGCCGCCGCCCTGTCCGACGCCCTCGACCTGGAGATCAAGGTGAC
CAAGTCCATCCGCAAGCTGATCCAGACCTGCGAGAACAAGCCCTACAACC
ACTACCACCTGGTGGACTACCTGACCGGTGTCTATCTGGAGGAGCAGCTC
CACGGACAGCGCGAGCTCGCCGGCAAGCTGACCACTCTCAAGAAGATGAT
GGACACCAACGGCGAACTGGGCGAGTTCCTGTTCGACAAGACCCTGTAAG
GAGGTGGAGATAGAGAAGGCGCAGCGCCCAGTCACGCATCAAAATTATCA
GCCAGTCGAGTTATCTGTTATCTGTCAGCCCAGAGAGCCTTCCCGAGGGT
CCGCTATTAAATCATCACCAGCCAAGTCGGCGACTGGCCAATAAATTATC
CGTTCGACTGCGATCCTCAAACCAGCACAGCAAAAAAAAAAAAAAAAA

MIP02909.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
Fer1HCH.a 1304 Fer1HCH.a 81..1065 1..985 4925 100 Plus
Fer1HCH.b 1243 Fer1HCH.b 69..1004 50..985 4680 100 Plus
Fer1HCH-RC 1505 Fer1HCH-RC 530..1266 249..985 3685 100 Plus
Fer1HCH-RC 1505 Fer1HCH-RC 393..529 1..137 685 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:14:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26208327..26208782 981..526 2265 99.8 Minus
chr3R 27901430 chr3R 26208844..26209123 526..247 1385 99.6 Minus
chr3R 27901430 chr3R 26209988..26210124 137..1 655 98.5 Minus
chr3R 27901430 chr3R 26209242..26209353 249..138 530 98.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:01:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:14:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30385798..30386257 985..526 2300 100 Minus
3R 32079331 3R 30386319..30386598 526..247 1400 100 Minus
3R 32079331 3R 30387464..30387600 137..1 685 100 Minus
3R 32079331 3R 30386717..30386828 249..138 560 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30126629..30127088 985..526 2300 100 Minus
3R 31820162 3R 30127150..30127429 526..247 1400 100 Minus
3R 31820162 3R 30128295..30128431 137..1 685 100 Minus
3R 31820162 3R 30127548..30127659 249..138 560 100 Minus
Blast to na_te.dros performed on 2019-03-17 00:14:28 has no hits.

MIP02909.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:15:20 Download gff for MIP02909.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26208327..26208781 527..981 99 <- Minus
chr3R 26208844..26209121 249..526 99 <- Minus
chr3R 26209243..26209353 138..248 98 <- Minus
chr3R 26209988..26210124 1..137 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:50:31 Download gff for MIP02909.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1HCH-RC 57..618 238..799 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:27:37 Download gff for MIP02909.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1HCH-RC 57..618 238..799 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:33:39 Download gff for MIP02909.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1HCH-RF 1..729 71..799 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:15:44 Download gff for MIP02909.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1HCH-RF 1..729 71..799 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-12 18:21:22 Download gff for MIP02909.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1HCH-RD 353..478 1..126 100 == Plus
Fer1HCH-RD 479..1222 238..981 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:27:37 Download gff for MIP02909.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1HCH-RD 353..478 1..126 100 == Plus
Fer1HCH-RD 479..1222 238..981 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:33:39 Download gff for MIP02909.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1HCH-RF 1..981 1..981 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:15:44 Download gff for MIP02909.complete
Subject Subject Range Query Range Percent Splice Strand
Fer1HCH-RF 1..981 1..981 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:15:20 Download gff for MIP02909.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30385802..30386256 527..981 100 <- Minus
3R 30386319..30386596 249..526 100 <- Minus
3R 30386718..30386828 138..248 100 <- Minus
3R 30387464..30387600 1..137 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:15:20 Download gff for MIP02909.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30385802..30386256 527..981 100 <- Minus
3R 30386319..30386596 249..526 100 <- Minus
3R 30386718..30386828 138..248 100 <- Minus
3R 30387464..30387600 1..137 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:15:20 Download gff for MIP02909.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30385802..30386256 527..981 100 <- Minus
3R 30386319..30386596 249..526 100 <- Minus
3R 30386718..30386828 138..248 100 <- Minus
3R 30387464..30387600 1..137 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:33:39 Download gff for MIP02909.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26213186..26213322 1..137 100   Minus
arm_3R 26211524..26211978 527..981 100 <- Minus
arm_3R 26212041..26212318 249..526 100 <- Minus
arm_3R 26212440..26212550 138..248 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:00:14 Download gff for MIP02909.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30127150..30127427 249..526 100 <- Minus
3R 30127549..30127659 138..248 100 <- Minus
3R 30128295..30128431 1..137 100   Minus
3R 30126633..30127087 527..981 100 <- Minus

MIP02909.pep Sequence

Translation from 70 to 798

> MIP02909.pep
MVKLIASLLLLAVVAQAYGDFKSKQESKSFVRELQREREEHQLKEKQNLS
HEGQDQECKGSLAVPEITKDWVDMKDACIKGMRNQIQEEINASYQYLAMG
AYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLIN
VPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDY
LTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL*

MIP02909.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:14:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16185-PA 205 GF16185-PA 1..205 1..242 794 67.8 Plus
Dana\GF20872-PA 189 GF20872-PA 24..179 77..242 223 33.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:14:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11946-PA 205 GG11946-PA 1..205 1..242 1028 83.1 Plus
Dere\GG19524-PA 189 GG19524-PA 23..178 77..242 226 33.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:14:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18415-PA 212 GH18415-PA 1..212 1..242 682 56.9 Plus
Dgri\GH24547-PA 190 GH24547-PA 24..179 77..242 224 32.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
Fer1HCH-PG 242 CG2216-PG 1..242 1..242 1243 100 Plus
Fer1HCH-PF 242 CG2216-PF 1..242 1..242 1243 100 Plus
Fer1HCH-PI 245 CG2216-PI 1..245 1..242 1229 98.8 Plus
Fer1HCH-PD 205 CG2216-PD 1..205 1..242 997 84.3 Plus
Fer1HCH-PC 205 CG2216-PC 1..205 1..242 997 84.3 Plus
Fer1HCH-PB 205 CG2216-PB 1..205 1..242 997 84.3 Plus
Fer1HCH-PA 205 CG2216-PA 1..205 1..242 997 84.3 Plus
Fer1HCH-PJ 169 CG2216-PJ 1..169 74..242 876 100 Plus
Fer1HCH-PE 121 CG2216-PE 1..115 1..152 530 75 Plus
Fer3HCH-PA 186 CG4349-PA 23..176 77..240 225 35.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:14:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24318-PA 194 GI24318-PA 18..194 69..242 656 70.8 Plus
Dmoj\GI16260-PA 190 GI16260-PA 23..178 77..242 220 32.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:14:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14055-PA 206 GL14055-PA 1..206 1..242 888 72.4 Plus
Dper\GL16490-PA 194 GL16490-PA 24..179 77..242 232 33.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:14:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15307-PC 206 GA15307-PC 1..206 1..242 888 72.4 Plus
Dpse\GA15307-PB 206 GA15307-PB 1..206 1..242 888 72.4 Plus
Dpse\GA15307-PA 206 GA15307-PA 1..206 1..242 888 72.4 Plus
Dpse\GA22605-PA 273 GA22605-PA 103..258 77..242 235 33.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:14:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12162-PA 205 GM12162-PA 1..205 1..242 1029 83.1 Plus
Dsec\GM11516-PA 186 GM11516-PA 23..178 77..242 238 35.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:14:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17157-PA 205 GD17157-PA 1..205 1..242 1032 83.5 Plus
Dsim\GD15908-PA 186 GD15908-PA 23..178 77..242 238 35.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:14:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10402-PA 212 GJ10402-PA 1..212 1..242 672 58.1 Plus
Dvir\GJ16902-PA 193 GJ16902-PA 23..178 77..242 223 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:14:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13135-PA 245 GK13135-PA 1..245 1..242 950 75.7 Plus
Dwil\GK25020-PA 202 GK25020-PA 28..182 78..242 244 34.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Fer1HCH-PA 205 GE23394-PA 1..205 1..242 1024 82.2 Plus
Dyak\GE16178-PA 186 GE16178-PA 19..178 73..242 220 32.6 Plus

MIP02909.hyp Sequence

Translation from 70 to 798

> MIP02909.hyp
MVKLIASLLLLAVVAQAYGDFKSKQESKSFVRELQREREEHQLKEKQNLS
HEGQDQECKGSLAVPEITKDWVDMKDACIKGMRNQIQEEINASYQYLAMG
AYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLIN
VPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDY
LTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDKTL*

MIP02909.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
Fer1HCH-PG 242 CG2216-PG 1..242 1..242 1243 100 Plus
Fer1HCH-PF 242 CG2216-PF 1..242 1..242 1243 100 Plus
Fer1HCH-PI 245 CG2216-PI 1..245 1..242 1229 98.8 Plus
Fer1HCH-PD 205 CG2216-PD 1..205 1..242 997 84.3 Plus
Fer1HCH-PC 205 CG2216-PC 1..205 1..242 997 84.3 Plus