Clone MIP03149 Report

Search the DGRC for MIP03149

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:31
Well:49
Vector:pOT2
Associated Gene/TranscriptCG8331-RB
Protein status:MIP03149.pep: gold
Sequenced Size:792

Clone Sequence Records

MIP03149.complete Sequence

792 bp assembled on 2011-03-15

GenBank Submission: BT126142.1

> MIP03149.complete
CATTCCATTGCCATATTCTCTAGACGAAGATCTGGAGAAAGTCCAGTTCG
GCGGGGTCAAAAGGTCTGAATTATTGAGACGTGGCGCTGTCGGCACACGT
GGAGCCAATCTACTCACTCACCTGTGTGCGTTGGTAGAGCTTTCAGTTCG
TTCGTTCGGTGCTCACCGGAGTTACCGATGTGGCTCTGGGACTATATTAT
GCTAATCAGACAGCGACAGGAGACGCGGCGCAATGTCAGAGTTCCCTTGG
TTTACCTCGGCATAGGTGCTGTTGGTCTGTGCGCCATCTACCTGATCTTT
GGCTGGGGCGCCCAACTACTGTGCAACATCATTGGGGTTCTGTACCCTGC
ATATATTTCCATCCATGCCATCGAGTCCAGCACAAAGCAGGACGACACCA
AGTGGCTGATCTACTGGGTCACGTTTGGAATCTTCACCGTGATTGAATTC
TTTTCGAGTCTGCTAACTTCGGTGATTCCCTTTTACTGGCTGCTGAAGTG
TGCTTTCCTCATCTGGTGCATGCTGCCCACGGAACAGAATGGTTCTACCA
TCATCTACAACAAGCTGGTGCGACCCTACTTCCTGAAACATCACGAATCC
GTTGACAGGATCATCGATGATGGCATGAAGAAAGCCGCTGGAGTGCTGAA
GCATGACTAGAAGGCGAATGTACCGTAGCTCCGACCGCTTCTCGCTTATC
CATGCATTTGGTTTTGGGCCTGGTCACCAACCTCACCTCGTATTGGTTAC
GTTTTGCAATAAATTTTAATTCTGTAAAAAAAAAAAAAAAAA

MIP03149.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:29:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10058496..10058763 1..268 1340 100 Plus
chr2R 21145070 chr2R 10059596..10059831 263..498 1180 100 Plus
chr3R 27901430 chr3R 21609728..21610059 611..280 1105 88.9 Minus
chr2R 21145070 chr2R 10060056..10060232 599..775 885 100 Plus
chr2R 21145070 chr2R 10059891..10059992 497..598 510 100 Plus
chr3R 27901430 chr3R 21609609..21609680 770..699 195 84.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:29:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14171187..14171454 1..268 1340 100 Plus
2R 25286936 2R 14172287..14172522 263..498 1180 100 Plus
3R 32079331 3R 25786726..25787057 611..280 1090 88.6 Minus
2R 25286936 2R 14172747..14172924 599..776 890 100 Plus
2R 25286936 2R 14172582..14172683 497..598 510 100 Plus
3R 32079331 3R 25786607..25786678 770..699 195 84.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14172386..14172653 1..268 1340 100 Plus
2R 25260384 2R 14173486..14173721 263..498 1180 100 Plus
3R 31820162 3R 25527557..25527888 611..280 1090 88.5 Minus
2R 25260384 2R 14173946..14174123 599..776 890 100 Plus
2R 25260384 2R 14173781..14173882 497..598 510 100 Plus
3R 31820162 3R 25527438..25527509 770..699 195 84.7 Minus
Blast to na_te.dros performed on 2019-03-16 22:29:45 has no hits.

MIP03149.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:30:33 Download gff for MIP03149.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10058496..10058760 1..265 100 -> Plus
chr2R 10059599..10059831 266..498 100 -> Plus
chr2R 10059893..10059992 499..598 100 -> Plus
chr2R 10060056..10060232 599..775 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-15 14:35:44 Download gff for MIP03149.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RB 1..483 178..660 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:56:18 Download gff for MIP03149.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RB 1..483 178..660 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:28:36 Download gff for MIP03149.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RB 1..483 178..660 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-15 14:35:44 Download gff for MIP03149.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RB 45..819 1..775 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:56:18 Download gff for MIP03149.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RB 28..802 1..775 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:28:36 Download gff for MIP03149.complete
Subject Subject Range Query Range Percent Splice Strand
CG8331-RB 28..802 1..775 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:30:33 Download gff for MIP03149.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14171187..14171451 1..265 100 -> Plus
2R 14172290..14172522 266..498 100 -> Plus
2R 14172584..14172683 499..598 100 -> Plus
2R 14172747..14172923 599..775 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:30:33 Download gff for MIP03149.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14171187..14171451 1..265 100 -> Plus
2R 14172290..14172522 266..498 100 -> Plus
2R 14172584..14172683 499..598 100 -> Plus
2R 14172747..14172923 599..775 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:30:33 Download gff for MIP03149.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14171187..14171451 1..265 100 -> Plus
2R 14172290..14172522 266..498 100 -> Plus
2R 14172584..14172683 499..598 100 -> Plus
2R 14172747..14172923 599..775 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:56:18 Download gff for MIP03149.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10058692..10058956 1..265 100 -> Plus
arm_2R 10059795..10060027 266..498 100 -> Plus
arm_2R 10060089..10060188 499..598 100 -> Plus
arm_2R 10060252..10060428 599..775 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:49:29 Download gff for MIP03149.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14173489..14173721 266..498 100 -> Plus
2R 14173783..14173882 499..598 100 -> Plus
2R 14173946..14174122 599..775 100   Plus
2R 14172386..14172650 1..265 100 -> Plus

MIP03149.pep Sequence

Translation from 177 to 659

> MIP03149.pep
MWLWDYIMLIRQRQETRRNVRVPLVYLGIGAVGLCAIYLIFGWGAQLLCN
IIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVI
PFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGM
KKAAGVLKHD*

MIP03149.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12032-PA 181 GF12032-PA 35..181 14..160 652 84.4 Plus
Dana\GF13556-PA 290 GF13556-PA 7..114 45..153 202 32.1 Plus
Dana\GF20320-PA 267 GF20320-PA 1..109 39..146 164 30 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20429-PA 181 GG20429-PA 51..181 30..160 651 92.4 Plus
Dere\GG12216-PA 164 GG12216-PA 43..164 22..143 556 84.4 Plus
Dere\GG22816-PA 285 GG22816-PA 7..114 45..153 203 32.1 Plus
Dere\GG18428-PA 244 GG18428-PA 1..108 39..146 161 30 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21843-PA 181 GH21843-PA 51..181 30..160 586 82.4 Plus
Dgri\GH20967-PA 281 GH20967-PA 7..114 45..153 192 30.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
ReepB-PB 160 CG8331-PB 1..160 1..160 862 100 Plus
ReepB-PD 178 CG8331-PD 40..178 22..160 711 95.7 Plus
ReepB-PA 178 CG8331-PA 40..178 22..160 711 95.7 Plus
ReepB-PC 153 CG8331-PC 20..153 27..160 707 98.5 Plus
CG4960-PB 174 CG4960-PB 43..174 22..160 538 72.7 Plus
CG4960-PA 174 CG4960-PA 43..174 22..160 538 72.7 Plus
ReepA-PO 291 CG42678-PO 122..260 21..152 214 29.3 Plus
ReepA-PD 435 CG30193-PD 122..260 21..152 214 29.3 Plus
ReepA-PR 459 CG42678-PR 122..260 21..152 214 29.3 Plus
ReepA-PQ 685 CG42678-PQ 122..260 21..152 214 29.3 Plus
ReepA-PI 716 CG42678-PI 122..260 21..152 214 29.3 Plus
ReepA-PG 288 CG30193-PG 7..113 45..152 211 32.4 Plus
ReepA-PE 288 CG30193-PE 7..113 45..152 211 32.4 Plus
ReepA-PS 312 CG42678-PS 7..113 45..152 211 32.4 Plus
ReepA-PP 538 CG42678-PP 7..113 45..152 211 32.4 Plus
ReepA-PH 569 CG42678-PH 7..113 45..152 211 32.4 Plus
ReepA-PJ 570 CG42678-PJ 7..113 45..152 211 32.4 Plus
Reepl1-PA 240 CG11697-PA 1..107 39..146 154 30 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19086-PA 181 GI19086-PA 38..181 17..160 588 76.4 Plus
Dmoj\GI21304-PA 281 GI21304-PA 7..113 45..152 190 30.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17205-PA 181 GL17205-PA 38..181 17..160 639 81.9 Plus
Dper\GL11033-PA 288 GL11033-PA 3..114 40..152 143 25.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20994-PA 181 GA20994-PA 38..181 17..160 639 81.9 Plus
Dpse\GA30269-PA 550 GA30269-PA 7..114 45..153 214 32.1 Plus
Dpse\GA30269-PG 693 GA30269-PG 118..257 21..153 213 30.5 Plus
Dpse\GA30269-PB 250 GA30269-PB 7..114 45..153 198 32.1 Plus
Dpse\GA30269-PC 393 GA30269-PC 118..257 21..153 197 28.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21516-PA 181 GM21516-PA 43..181 22..160 695 95 Plus
Dsec\GM10217-PA 177 GM10217-PA 46..158 25..137 491 80.5 Plus
Dsec\GM15973-PA 288 GM15973-PA 7..114 45..153 202 32.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11027-PA 181 GD11027-PA 43..181 22..160 695 95 Plus
Dsim\GD18168-PA 177 GD18168-PA 46..158 25..137 491 80.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20059-PA 181 GJ20059-PA 36..181 9..160 618 76.3 Plus
Dvir\GJ21570-PA 284 GJ21570-PA 1..113 39..152 191 29.8 Plus
Dvir\GJ15630-PA 320 GJ15630-PA 4..115 46..159 152 27.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21552-PA 181 GK21552-PA 51..181 30..160 619 87.8 Plus
Dwil\GK19544-PA 281 GK19544-PA 7..114 45..153 191 30.3 Plus
Dwil\GK19241-PA 267 GK19241-PA 14..129 51..157 154 27.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:09:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13560-PA 181 GE13560-PA 38..181 17..160 674 88.2 Plus
Dyak\GE10663-PA 175 GE10663-PA 51..170 30..149 562 85.8 Plus
Dyak\GE14249-PA 286 GE14249-PA 7..114 45..153 202 32.1 Plus
Dyak\GE15946-PA 241 GE15946-PA 1..108 39..146 162 30.9 Plus

MIP03149.hyp Sequence

Translation from 177 to 659

> MIP03149.hyp
MWLWDYIMLIRQRQETRRNVRVPLVYLGIGAVGLCAIYLIFGWGAQLLCN
IIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVI
PFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGM
KKAAGVLKHD*

MIP03149.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG8331-PB 160 CG8331-PB 1..160 1..160 862 100 Plus
CG8331-PD 178 CG8331-PD 40..178 22..160 711 95.7 Plus
CG8331-PA 178 CG8331-PA 40..178 22..160 711 95.7 Plus
CG8331-PC 153 CG8331-PC 20..153 27..160 707 98.5 Plus
CG4960-PB 174 CG4960-PB 43..174 22..160 538 72.7 Plus