Clone MIP03207 Report

Search the DGRC for MIP03207

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:32
Well:7
Vector:pOT2
Associated Gene/TranscriptCG33098-RB
Protein status:MIP03207.pep: gold
Sequenced Size:1187

Clone Sequence Records

MIP03207.complete Sequence

1187 bp assembled on 2009-01-27

GenBank Submission: BT058059.1

> MIP03207.complete
GAAAACGCGTCCGAATCGCTTTGAAATCGCGAGCAAGTCGAGTGTCCTAG
TCGGTGGTTGATAGTGTTCCGTGTTGAAAGTCGTTTGTTCAATCCGTCGA
AAGCTATTTGTAAGTGATCAAAAGAGTTGGTAGTGCAAAAACTCCGTCAA
AATGTCGATGGATCCATCGGTTTCTCTAGAGGATCTGGAGCGACGTCGTC
GTCGCGCCAGTTCCGCCCGCAAGCAGTCACATACTCCCCAGCCAGCATCT
CACCTGGCGGATTCGGAGGCCATGGCCGTAATCAATGAGATATTTAATCC
CACGCTGAAGCTGCCGGAGTCCAGTGGCCACTATACGCTGCCCGAGGAGA
TGAGGGCCGATGATAATGTGGCGCCCCATGAACTGGACATTGCCAAGCTG
GCGGAGCTGAAGGAAGTCTTCTCGCTCTTCGATACGGACTGCGATGGACT
GATCTCGAAGGATGATCTACGGTTCACCTACACGGCGCTGGGCAACGAAC
CGAACGAACAGCTACTGGAACAGATGATGCAGGAGGCCAAGGAGCCGCTC
GACTATGAAGCCTTCGTTCGGCTGATGAGTCGTCGCACCCAGGAACTGGA
TCCCGAGGATGTTTTGTTGGAGGCCTGGAGCAAATGGGATGACCATGGCA
CGGGCAAGATCGACGAACGCAAAATCTATGAAGAGCTGACCAACTATGGT
GACAAAATGACCCTCAACGAGGCCAAGGAGGCTCTTAGCCACGCCCCGAT
GGCCAAGCCCAAGTCCTTGGAGGAGCCGCCCATGATCGATTACCCGGCCT
TCTGTCGCATGCTAAGTGGAATGCGGAAGCGGAAAGGGGAATAACGTGCT
ATTTTTGGGAGAAACTTTAAAAGTTTACTTTAAATTCAAATCCATTAAAT
ATTTTCTGATTTAATGTTTTTTTTTCAGTTAACCTACTAATATACAAGCT
CTTTCATTTCATATCATTTACCCTATGAAATTTATATTCTTTCTAGATCA
ATTTTGAAAACCTTTCGCAGCTATTGTTGCGTTTCTGATTATGATTTTAT
AGCCTTAGATTGTTATTTGATTGGTAAATATTTTGAAGCAGCTGTGCCGA
TTTGACAATCGTATTAGCCTTAACGCCAACTTTTGTTCGACTTTTTATCA
AAATAAATCGTGAAGAACCAAAAAAAAAAAAAAAAAA

MIP03207.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:22:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG33098.a 1293 CG33098.a 122..1291 1..1170 5850 100 Plus
CG33098-RB 1077 CG33098-RB 4..1075 99..1170 5360 100 Plus
CG33098-RC 1015 CG33098-RC 1..552 121..672 2760 100 Plus
CG33098-RC 1015 CG33098-RC 615..1015 673..1073 2005 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:07:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8213680..8214180 673..1169 2410 99.2 Plus
chr3R 27901430 chr3R 8213361..8213617 416..672 1285 100 Plus
chr3R 27901430 chr3R 8213087..8213310 194..417 1120 100 Plus
chr3R 27901430 chr3R 8212570..8212668 1..99 495 100 Plus
chr3R 27901430 chr3R 8212925..8213019 99..193 475 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:01:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12388298..12388795 673..1170 2490 100 Plus
3R 32079331 3R 12387979..12388235 416..672 1285 100 Plus
3R 32079331 3R 12387705..12387928 194..417 1120 100 Plus
3R 32079331 3R 12387188..12387286 1..99 495 100 Plus
3R 32079331 3R 12387543..12387637 99..193 475 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12129129..12129626 673..1170 2490 100 Plus
3R 31820162 3R 12128810..12129066 416..672 1285 100 Plus
3R 31820162 3R 12128536..12128759 194..417 1120 100 Plus
3R 31820162 3R 12128019..12128117 1..99 495 100 Plus
3R 31820162 3R 12128374..12128468 99..193 475 100 Plus
Blast to na_te.dros performed on 2019-03-17 00:07:14 has no hits.

MIP03207.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:08:09 Download gff for MIP03207.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8212570..8212668 1..99 100 -> Plus
chr3R 8212926..8213019 100..193 100 -> Plus
chr3R 8213087..8213308 194..415 100 -> Plus
chr3R 8213361..8213617 416..672 100 -> Plus
chr3R 8213680..8214180 673..1169 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:01 Download gff for MIP03207.complete
Subject Subject Range Query Range Percent Splice Strand
CG33098-RB 1..693 152..844 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:33:46 Download gff for MIP03207.complete
Subject Subject Range Query Range Percent Splice Strand
CG33098-RB 1..693 152..844 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:30:51 Download gff for MIP03207.complete
Subject Subject Range Query Range Percent Splice Strand
CG33098-RB 1..693 152..844 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:12:44 Download gff for MIP03207.complete
Subject Subject Range Query Range Percent Splice Strand
CG33098-RB 1..693 152..844 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-01-27 09:19:44 Download gff for MIP03207.complete
Subject Subject Range Query Range Percent Splice Strand
CG33098-RB 1..1049 121..1169 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:33:45 Download gff for MIP03207.complete
Subject Subject Range Query Range Percent Splice Strand
CG33098-RB 1..1049 121..1169 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:30:51 Download gff for MIP03207.complete
Subject Subject Range Query Range Percent Splice Strand
CG33098-RE 1..1169 1..1169 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:12:44 Download gff for MIP03207.complete
Subject Subject Range Query Range Percent Splice Strand
CG33098-RE 1..1169 1..1169 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:08:09 Download gff for MIP03207.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12387188..12387286 1..99 100 -> Plus
3R 12387544..12387637 100..193 100 -> Plus
3R 12387705..12387926 194..415 100 -> Plus
3R 12387979..12388235 416..672 100 -> Plus
3R 12388298..12388794 673..1169 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:08:09 Download gff for MIP03207.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12387188..12387286 1..99 100 -> Plus
3R 12387544..12387637 100..193 100 -> Plus
3R 12387705..12387926 194..415 100 -> Plus
3R 12387979..12388235 416..672 100 -> Plus
3R 12388298..12388794 673..1169 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:08:09 Download gff for MIP03207.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12387188..12387286 1..99 100 -> Plus
3R 12387544..12387637 100..193 100 -> Plus
3R 12387705..12387926 194..415 100 -> Plus
3R 12387979..12388235 416..672 100 -> Plus
3R 12388298..12388794 673..1169 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:30:51 Download gff for MIP03207.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8213701..8213957 416..672 100 -> Plus
arm_3R 8212910..8213008 1..99 100 -> Plus
arm_3R 8213266..8213359 100..193 100 -> Plus
arm_3R 8213427..8213648 194..415 100 -> Plus
arm_3R 8214020..8214516 673..1169 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:07:03 Download gff for MIP03207.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12128536..12128757 194..415 100 -> Plus
3R 12128810..12129066 416..672 100 -> Plus
3R 12129129..12129625 673..1169 100   Plus
3R 12128019..12128117 1..99 100 -> Plus
3R 12128375..12128468 100..193 100 -> Plus

MIP03207.pep Sequence

Translation from 151 to 843

> MIP03207.pep
MSMDPSVSLEDLERRRRRASSARKQSHTPQPASHLADSEAMAVINEIFNP
TLKLPESSGHYTLPEEMRADDNVAPHELDIAKLAELKEVFSLFDTDCDGL
ISKDDLRFTYTALGNEPNEQLLEQMMQEAKEPLDYEAFVRLMSRRTQELD
PEDVLLEAWSKWDDHGTGKIDERKIYEELTNYGDKMTLNEAKEALSHAPM
AKPKSLEEPPMIDYPAFCRMLSGMRKRKGE*

MIP03207.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17950-PA 230 GF17950-PA 1..230 1..230 1125 94.3 Plus
Dana\GF20304-PA 174 GF20304-PA 19..173 68..230 229 34.4 Plus
Dana\GF12835-PA 149 GF12835-PA 9..147 82..222 187 30.3 Plus
Dana\GF22746-PA 184 GF22746-PA 35..163 76..200 149 27.9 Plus
Dana\GF16771-PA 165 GF16771-PA 16..163 73..222 145 29.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18839-PA 230 GG18839-PA 1..230 1..230 1195 98.3 Plus
Dere\GG17688-PA 174 GG17688-PA 19..173 68..230 229 34.4 Plus
Dere\GG20265-PA 149 GG20265-PA 9..147 82..222 187 30.3 Plus
Dere\GG21714-PA 186 GG21714-PA 36..166 75..201 150 28.2 Plus
Dere\GG21382-PA 182 GG21382-PA 33..161 76..200 146 28.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20591-PA 228 GH20591-PA 1..228 1..229 996 86 Plus
Dgri\GH24837-PA 174 GH24837-PA 19..173 68..230 226 33.7 Plus
Dgri\GH10976-PA 190 GH10976-PA 41..169 76..200 154 29.5 Plus
Dgri\GH22800-PA 122 GH22800-PA 2..104 72..170 150 34 Plus
Dgri\GH23405-PA 151 GH23405-PA 2..149 75..222 150 30.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG33098-PF 230 CG33098-PF 1..230 1..230 1196 100 Plus
CG33098-PE 230 CG33098-PE 1..230 1..230 1196 100 Plus
CG33098-PB 230 CG33098-PB 1..230 1..230 1196 100 Plus
CG33098-PC 199 CG33098-PC 1..174 1..174 900 100 Plus
CG33098-PD 164 CG33098-PD 1..164 67..230 862 100 Plus
sqh-PE 174 CG3595-PE 13..173 62..230 235 33.7 Plus
sqh-PD 174 CG3595-PD 13..173 62..230 235 33.7 Plus
sqh-PC 174 CG3595-PC 13..173 62..230 235 33.7 Plus
sqh-PB 174 CG3595-PB 13..173 62..230 235 33.7 Plus
sqh-PA 174 CG3595-PA 13..173 62..230 235 33.7 Plus
Mlc2-PA 222 CG2184-PA 23..219 19..230 197 28.8 Plus
Cam-PD 149 CG8472-PD 4..147 77..222 190 30 Plus
Cam-PC 149 CG8472-PC 4..147 77..222 190 30 Plus
Cam-PE 149 CG8472-PE 4..147 77..222 190 30 Plus
Cam-PB 149 CG8472-PB 4..147 77..222 190 30 Plus
Cam-PA 149 CG8472-PA 4..147 77..222 190 30 Plus
CG17493-PD 182 CG17493-PD 34..161 77..200 163 28.9 Plus
CG17493-PC 182 CG17493-PC 34..161 77..200 163 28.9 Plus
CG17493-PB 182 CG17493-PB 34..161 77..200 163 28.9 Plus
CG31802-PA 186 CG31802-PA 38..163 77..198 161 29.4 Plus
Acam-PB 148 CG17769-PB 3..146 77..222 151 28.7 Plus
Acam-PA 148 CG17769-PA 3..146 77..222 151 28.7 Plus
CG17770-PA 164 CG17770-PA 7..162 62..222 144 27.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 10:58:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23199-PA 520 GI23199-PA 1..229 1..228 996 87.3 Plus
Dmoj\GI16168-PA 174 GI16168-PA 19..173 68..230 231 34.4 Plus
Dmoj\GI20594-PA 149 GI20594-PA 9..147 82..222 187 30.3 Plus
Dmoj\GI20846-PA 184 GI20846-PA 34..163 75..200 149 30 Plus
Dmoj\GI10340-PA 150 GI10340-PA 3..148 75..222 145 28.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:58:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27306-PA 230 GL27306-PA 1..229 1..229 1055 91.7 Plus
Dper\GL10814-PA 149 GL10814-PA 9..147 82..222 187 30.3 Plus
Dper\GL21357-PA 127 GL21357-PA 6..126 103..230 165 32.8 Plus
Dper\GL26165-PA 192 GL26165-PA 43..171 76..200 154 29.5 Plus
Dper\GL21536-PA 148 GL21536-PA 3..146 77..222 143 27.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:58:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17278-PA 230 GA17278-PA 1..229 1..229 1055 91.7 Plus
Dpse\GA17546-PA 174 GA17546-PA 19..173 68..230 229 34.4 Plus
Dpse\GA15288-PB 222 GA15288-PB 76..212 82..223 216 33.1 Plus
Dpse\GA24499-PA 149 GA24499-PA 9..147 82..222 187 30.3 Plus
Dpse\GA26322-PA 148 GA26322-PA 3..146 77..222 143 27.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:58:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24024-PA 230 GM24024-PA 1..230 1..230 1219 100 Plus
Dsec\GM11056-PA 230 GM11056-PA 1..230 1..230 1219 100 Plus
Dsec\GM11055-PA 226 GM11055-PA 1..184 1..184 976 100 Plus
Dsec\GM19686-PA 141 GM19686-PA 1..114 1..114 592 98.2 Plus
Dsec\GM12587-PA 174 GM12587-PA 19..173 68..230 229 34.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:58:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18824-PA 196 GD18824-PA 1..194 1..192 859 91.2 Plus
Dsim\sqh-PA 174 GD16204-PA 19..173 68..230 229 34.4 Plus
Dsim\GD10849-PA 149 GD10849-PA 9..147 82..222 187 30.3 Plus
Dsim\GD21839-PA 186 GD21839-PA 36..166 75..201 150 28.2 Plus
Dsim\GD21235-PA 148 GD21235-PA 3..146 77..222 139 28.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 10:58:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22859-PA 230 GJ22859-PA 1..230 1..229 1021 87 Plus
Dvir\GJ19134-PA 174 GJ19134-PA 19..173 68..230 229 34.4 Plus
Dvir\GJ16661-PA 174 GJ16661-PA 19..173 68..230 229 34.4 Plus
Dvir\GJ19846-PA 184 GJ19846-PA 34..163 75..200 160 30 Plus
Dvir\GJ15110-PA 190 GJ15110-PA 41..169 76..200 151 29.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:58:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11881-PA 230 GK11881-PA 1..230 1..230 1074 91.3 Plus
Dwil\GK17694-PA 174 GK17694-PA 19..173 68..230 224 33.7 Plus
Dwil\GK13145-PA 222 GK13145-PA 76..212 82..223 208 32.4 Plus
Dwil\GK22183-PA 149 GK22183-PA 9..147 82..222 187 30.3 Plus
Dwil\GK18988-PA 148 GK18988-PA 3..146 77..222 157 30 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:58:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26184-PA 230 GE26184-PA 1..230 1..230 1193 98.3 Plus
Dyak\sqh-PA 174 GE16476-PA 19..173 68..230 229 34.4 Plus
Dyak\Cam-PA 149 GE12425-PA 9..147 82..222 187 30.3 Plus
Dyak\GE12738-PA 186 GE12738-PA 36..166 75..201 151 28.2 Plus
Dyak\GE22672-PA 182 GE22672-PA 33..161 76..200 146 28.7 Plus

MIP03207.hyp Sequence

Translation from 151 to 843

> MIP03207.hyp
MSMDPSVSLEDLERRRRRASSARKQSHTPQPASHLADSEAMAVINEIFNP
TLKLPESSGHYTLPEEMRADDNVAPHELDIAKLAELKEVFSLFDTDCDGL
ISKDDLRFTYTALGNEPNEQLLEQMMQEAKEPLDYEAFVRLMSRRTQELD
PEDVLLEAWSKWDDHGTGKIDERKIYEELTNYGDKMTLNEAKEALSHAPM
AKPKSLEEPPMIDYPAFCRMLSGMRKRKGE*

MIP03207.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:24:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG33098-PF 230 CG33098-PF 1..230 1..230 1196 100 Plus
CG33098-PE 230 CG33098-PE 1..230 1..230 1196 100 Plus
CG33098-PB 230 CG33098-PB 1..230 1..230 1196 100 Plus
CG33098-PC 199 CG33098-PC 1..174 1..174 900 100 Plus
CG33098-PD 164 CG33098-PD 1..164 67..230 862 100 Plus