Clone MIP03678 Report

Search the DGRC for MIP03678

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:36
Well:78
Vector:pOT2
Associated Gene/TranscriptCG14445-RB
Protein status:MIP03678.pep: gold
Sequenced Size:1553

Clone Sequence Records

MIP03678.complete Sequence

1553 bp assembled on 2009-04-07

GenBank Submission: BT081991.1

> MIP03678.complete
CCCCAACCGCCGGCACCCTCAGCGAATTGCGATCGTTTTCGAATCGTTTT
TCGAATCGTTTTCGAGTAGATATCCGTTTGTTTTTTTTTTTTTTGCGTTC
CAAAACAGTTTTTTCCTGTGCCGCATTTTCTGAGCTTCAAACATGTCGTT
CCTGGGCAACACATCCGATCTGGAGTGCGAAAAGAACGAGTTCCCGAGGC
AGCGACCCTCGGGCATCATCACCAAGGTGGCCGCCCACAAGCTCTCCGCG
GAGCCCAAGTGGACGGACAAGCGGGAGGATGACTCCGATTCGGAGGTCTC
GTCGCCGGATAATTTCCTGACCAAAGGCGCCTTCCTATTGACCCCATCCT
ACGAGTTGTCCATGGAACGGGCGGCCCTCATCTGCGAGAAGATGGCATTC
AAGGGATGCTTCAGCTTGACCAAAACCGCTACAGGCATTCTGTTTAAATT
CTCACATCCAGATGACTATCAGGCGGTGTTCAAGAAGGGCTTCCACAAGG
TTACCGGGGCGCGATTCTACCGCAAGATTGCCATACCGTGTCGGCCGAGG
AAGACCTTCACCCTGTACGTGCTGGATGTGCCCGAGGATCTGCCCGTGGA
GGATATCCGGCATGCCATGTACAAGTTCGATTCGGTGGTGGAGGTGGTGC
GCCTGCACATCTACTCGAGCCTCGCCAGCAATGCCGCCAATGCCACCTCC
TCCTCCGCCGTTGCCGCCAGCAGCTCCTCCGGCGGCGGTGATAAGGGCGT
CGAAGGCGTCTCCAAGAGCGTGGGTTCTGTGGTGGGCGATGCCATCGAGA
AGGCCGAGCGTCCTGAGCGCAGAGAACTGCCTCCAGCCGTTATCCGGGTC
ACCCTGGCCTCCATGGATGAGTACAACATTCTGTTGCAGAACGGACTCAA
CTTCTACGATGCCACGTTCTTTCCCACTGAGGCCAACATCTCGCTGAAGG
GCGCCAAGATCGATTATAAGCGCAGAATGCTCGATGGCTCGATTCCCGGA
CGGGTGAGGGAACTGCTGCCCGTTTTCGATGCGGCTGGCTTCTGCAAGCT
GCCACCGCCCACCAGCAAGCTAATTAAGCCGCCGAGGTCGTAGATTCGAT
ACGATGCGATTACGATTACGATGACAACGCTTTCCGGCCAAATACACGGG
CCCCCATGACGACCACACTCCGGATTCGGTACTACCCAGTTTATCTTACC
CTACTTCGATGTATACTACATACTACATAATGCTCTTTTTAACGGATGCC
AACGTTTCCGCTCGATCCACCAATCCGATCCAATTCGATCCATAATAATT
ACCATCTATGTTTTTGTTGCCTTCTCCTTCCTATCTATCTATCTATCTGT
CTCTTTCCCCTGTGAACTTTTCAACCTTCTTCGCTCTGTTTTTTTTTTTT
TTTCTTTTTGCTAGTTTTATTATTAAAGGCCCATATAAGGCGTAGCGTCT
AATTCGTTTGATTGTCTAACAATGAAAAAAAAATAAGCAAAAACACAGAA
AAGAAACATAATAAAGATGAAATAAGAAAAAAAAAAAAAAAAAAAAAAAA
AAA

MIP03678.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG14445-RB 1560 CG14445-RB 20..1552 1..1532 7575 99.8 Plus
CG14445-RA 1675 CG14445-RA 870..1645 756..1532 3845 99.8 Plus
CG14445-RA 1675 CG14445-RA 53..810 1..756 3735 99.7 Plus
CG14445.a 1641 CG14445.a 897..1641 756..1501 3690 99.8 Plus
CG14445.a 1641 CG14445.a 20..547 1..526 2585 99.6 Plus
CG14445.a 1641 CG14445.a 604..837 523..756 1170 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:32:46
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6132193..6132746 973..1526 2675 99.6 Plus
chrX 22417052 chrX 6129523..6129851 1..327 1550 98.8 Plus
chrX 22417052 chrX 6131131..6131362 525..756 1160 100 Plus
chrX 22417052 chrX 6131573..6131794 754..975 1095 99.5 Plus
chrX 22417052 chrX 6130186..6130387 325..526 1010 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:02:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:32:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6240006..6240564 973..1532 2750 99.8 Plus
X 23542271 X 6237336..6237664 1..327 1580 99.4 Plus
X 23542271 X 6238944..6239175 525..756 1160 100 Plus
X 23542271 X 6239386..6239607 754..975 1110 100 Plus
X 23542271 X 6237999..6238200 325..526 1010 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6248104..6248662 973..1532 2760 99.8 Plus
X 23527363 X 6245434..6245762 1..327 1590 99.3 Plus
X 23527363 X 6247042..6247273 525..756 1160 100 Plus
X 23527363 X 6247484..6247705 754..975 1110 100 Plus
X 23527363 X 6246097..6246298 325..526 1010 100 Plus
Blast to na_te.dros performed 2019-03-16 18:32:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 743..864 1425..1300 160 61.9 Minus
Dvir\Helena 691 Dvir\Helena DV26847 691bp Derived from U26847 (Rel. 63, Last updated, Version 2). 642..691 1426..1377 151 78 Minus
Rt1a 5108 Rt1a DME278684 5108bp Derived from AJ278684 (AJ278684.1) (Rel. 64, Last updated, Version 1). 5072..5107 1427..1392 126 83.3 Minus
roo 9092 roo DM_ROO 9092bp 965..996 1424..1393 124 87.5 Minus

MIP03678.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:33:31 Download gff for MIP03678.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6130188..6130387 327..526 100 -> Plus
chrX 6131133..6131361 527..755 100 -> Plus
chrX 6131575..6131794 756..975 99 -> Plus
chrX 6132196..6132690 976..1471 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:00 Download gff for MIP03678.complete
Subject Subject Range Query Range Percent Splice Strand
CG14445-RB 1..951 143..1093 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:44:25 Download gff for MIP03678.complete
Subject Subject Range Query Range Percent Splice Strand
CG14445-RB 1..951 143..1093 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:24 Download gff for MIP03678.complete
Subject Subject Range Query Range Percent Splice Strand
CG14445-RB 1..951 143..1093 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:42:22 Download gff for MIP03678.complete
Subject Subject Range Query Range Percent Splice Strand
CG14445-RB 1..951 143..1093 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-07 17:48:42 Download gff for MIP03678.complete
Subject Subject Range Query Range Percent Splice Strand
CG14445-RB 20..1382 1..1361 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:44:25 Download gff for MIP03678.complete
Subject Subject Range Query Range Percent Splice Strand
CG14445-RB 20..1546 1..1526 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:24 Download gff for MIP03678.complete
Subject Subject Range Query Range Percent Splice Strand
CG14445-RB 22..1548 1..1526 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:42:22 Download gff for MIP03678.complete
Subject Subject Range Query Range Percent Splice Strand
CG14445-RB 22..1548 1..1526 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:31 Download gff for MIP03678.complete
Subject Subject Range Query Range Percent Splice Strand
X 6237336..6237663 1..326 99 -> Plus
X 6238001..6238200 327..526 100 -> Plus
X 6238946..6239174 527..755 100 -> Plus
X 6239388..6239607 756..975 100 -> Plus
X 6240009..6240558 976..1526 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:31 Download gff for MIP03678.complete
Subject Subject Range Query Range Percent Splice Strand
X 6237336..6237663 1..326 99 -> Plus
X 6238001..6238200 327..526 100 -> Plus
X 6238946..6239174 527..755 100 -> Plus
X 6239388..6239607 756..975 100 -> Plus
X 6240009..6240558 976..1526 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:31 Download gff for MIP03678.complete
Subject Subject Range Query Range Percent Splice Strand
X 6237336..6237663 1..326 99 -> Plus
X 6238001..6238200 327..526 100 -> Plus
X 6238946..6239174 527..755 100 -> Plus
X 6239388..6239607 756..975 100 -> Plus
X 6240009..6240558 976..1526 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:24 Download gff for MIP03678.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6132979..6133207 527..755 100 -> Plus
arm_X 6133421..6133640 756..975 100 -> Plus
arm_X 6131369..6131696 1..326 99 -> Plus
arm_X 6132034..6132233 327..526 100 -> Plus
arm_X 6134042..6134591 976..1526 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:19:32 Download gff for MIP03678.complete
Subject Subject Range Query Range Percent Splice Strand
X 6245434..6245761 1..326 99 -> Plus
X 6246099..6246298 327..526 100 -> Plus
X 6247044..6247272 527..755 100 -> Plus
X 6247486..6247705 756..975 100 -> Plus
X 6248107..6248656 976..1526 99   Plus

MIP03678.pep Sequence

Translation from 142 to 1092

> MIP03678.pep
MSFLGNTSDLECEKNEFPRQRPSGIITKVAAHKLSAEPKWTDKREDDSDS
EVSSPDNFLTKGAFLLTPSYELSMERAALICEKMAFKGCFSLTKTATGIL
FKFSHPDDYQAVFKKGFHKVTGARFYRKIAIPCRPRKTFTLYVLDVPEDL
PVEDIRHAMYKFDSVVEVVRLHIYSSLASNAANATSSSAVAASSSSGGGD
KGVEGVSKSVGSVVGDAIEKAERPERRELPPAVIRVTLASMDEYNILLQN
GLNFYDATFFPTEANISLKGAKIDYKRRMLDGSIPGRVRELLPVFDAAGF
CKLPPPTSKLIKPPRS*

MIP03678.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20384-PA 333 GF20384-PA 1..333 1..316 1491 85.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19575-PA 168 GG19575-PA 1..132 1..132 696 97 Plus
Dere\GG19576-PA 76 GG19576-PA 1..76 241..316 405 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17586-PA 304 GH17586-PA 1..304 1..316 1164 66.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG14445-PB 316 CG14445-PB 1..316 1..316 1625 100 Plus
CG14445-PA 336 CG14445-PA 1..336 1..316 1594 94 Plus
CG14445-PD 356 CG14445-PD 1..356 1..316 1563 88.8 Plus
CG14445-PC 362 CG14445-PC 1..362 1..316 1557 87.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16316-PA 308 GI16316-PA 1..308 1..316 1441 86.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:20:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21312-PA 280 GL21312-PA 1..280 1..316 1115 70.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12992-PA 324 GA12992-PA 1..324 1..316 1417 83.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12469-PA 356 GM12469-PA 1..356 1..316 1607 88.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16788-PA 275 GD16788-PA 1..249 1..205 1038 82.3 Plus
Dsim\GD16789-PA 61 GD16789-PA 5..61 260..316 287 96.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15654-PA 377 GJ15654-PA 1..189 1..205 915 83.9 Plus
Dvir\GJ15654-PA 377 GJ15654-PA 277..377 216..316 523 97 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15406-PA 347 GK15406-PA 1..342 1..311 1303 77.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16735-PA 168 GE16735-PA 1..130 1..130 694 97.7 Plus
Dyak\GE16737-PA 76 GE16737-PA 1..76 241..316 405 100 Plus

MIP03678.hyp Sequence

Translation from 142 to 1092

> MIP03678.hyp
MSFLGNTSDLECEKNEFPRQRPSGIITKVAAHKLSAEPKWTDKREDDSDS
EVSSPDNFLTKGAFLLTPSYELSMERAALICEKMAFKGCFSLTKTATGIL
FKFSHPDDYQAVFKKGFHKVTGARFYRKIAIPCRPRKTFTLYVLDVPEDL
PVEDIRHAMYKFDSVVEVVRLHIYSSLASNAANATSSSAVAASSSSGGGD
KGVEGVSKSVGSVVGDAIEKAERPERRELPPAVIRVTLASMDEYNILLQN
GLNFYDATFFPTEANISLKGAKIDYKRRMLDGSIPGRVRELLPVFDAAGF
CKLPPPTSKLIKPPRS*

MIP03678.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG14445-PB 316 CG14445-PB 1..316 1..316 1625 100 Plus
CG14445-PA 336 CG14445-PA 1..336 1..316 1594 94 Plus
CG14445-PD 356 CG14445-PD 1..356 1..316 1563 88.8 Plus
CG14445-PC 362 CG14445-PC 1..362 1..316 1557 87.3 Plus