Clone MIP03712 Report

Search the DGRC for MIP03712

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:37
Well:12
Vector:pOT2
Associated Gene/TranscriptSclp-RB
Protein status:MIP03712.pep: gold
Sequenced Size:798

Clone Sequence Records

MIP03712.complete Sequence

798 bp assembled on 2009-03-09

GenBank Submission: BT072930.1

> MIP03712.complete
AGAGAATCGGAAAGTTATATATATATATATATCTATATATACATATAGGT
ATAGTGATAAGGCTGGTTACGATCGCTAGTAATCGAGGAGATCGCATGGA
AACTTGGAGATGGCGCACTTGGTGGTTAGGGTGATTGAGCGTTGTGAGAA
TGCCAACGAAAGTGCTCATTTAGATCTTTCAAGTTGTGAACTGATGCAAA
TACCAGATGCGGTATATCATCTTATGCGAAACACAGAGTTGATCACCTGC
AATCTCAGTGGCAATGTGCTCAAAAGCGTTTCGCCCAAGTTTTCGCAAAA
GTTTAGTACCATCACAGATCTTAATCTGTCACACAACAAACTGTCGAGGC
TGCCAGAAGAATTCGCCAGCTTGTCTGCGCTAACCAAGCTGAATATCTCG
AACAATTCATTTATCGTTTTGCCACAAGTAGTCTTTAAGCTTCAGAGTCT
TGCCAGTCTGGATGCCCAGAACAATGCCATTTTGGAAATTGATACCGATG
AGGCAATTACCAGTGACAATTTGGCCCTCGTTGATCTTCGGAATAATCCG
CTGAGCAGAAACTGCCGACGAAAGCTGCAGAGCTTCAAGACCCCCTTCCA
CCTTGAGATCTCCAAGGATGTCGAAGACGACTGGTAAACCGGATGAATGT
CCTGTCCATTCATTTTCCAACACACCACAAACAAATCTCTCGTTATCTCG
AAAGAGAGCGCCCTAAACGGCCCTCCTTCAACTTATTTATTCTGTTTATA
AATTTATATATATATTTATCAAAAACCAAAAAAAAAAAAAAAAAAAAA

MIP03712.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Sclp-RB 836 Sclp-RB 17..794 1..778 3890 100 Plus
Sclp-RA 1172 Sclp-RA 525..1130 173..778 3030 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:14:56
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11812780..11813072 777..485 1465 100 Minus
chrX 22417052 chrX 11813727..11813899 173..1 865 100 Minus
chrX 22417052 chrX 11813137..11813307 485..315 840 99.4 Minus
chrX 22417052 chrX 11813369..11813514 317..172 700 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:02:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11921639..11921932 778..485 1470 100 Minus
X 23542271 X 11922588..11922760 173..1 865 100 Minus
X 23542271 X 11921998..11922168 485..315 855 100 Minus
X 23542271 X 11922230..11922375 317..172 730 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:42:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11929737..11930030 778..485 1470 100 Minus
X 23527363 X 11930686..11930858 173..1 865 100 Minus
X 23527363 X 11930096..11930266 485..315 855 100 Minus
X 23527363 X 11930328..11930473 317..172 730 100 Minus
Blast to na_te.dros performed 2019-03-15 17:14:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Kepler 722 Dbuz\Kepler KEPLER 722bp 437..498 769..709 109 66.1 Minus
Dbuz\Kepler 722 Dbuz\Kepler KEPLER 722bp 429..468 731..769 107 77.5 Plus

MIP03712.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:15:39 Download gff for MIP03712.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11813369..11813512 174..317 98 <- Minus
chrX 11813727..11813850 50..173 100 <- Minus
chrX 11812816..11813071 486..741 100 <- Minus
chrX 11813137..11813304 318..485 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:07:18 Download gff for MIP03712.complete
Subject Subject Range Query Range Percent Splice Strand
Sclp-RA 286..750 173..637 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:38:48 Download gff for MIP03712.complete
Subject Subject Range Query Range Percent Splice Strand
Sclp-RB 1..528 110..637 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:17:46 Download gff for MIP03712.complete
Subject Subject Range Query Range Percent Splice Strand
Sclp-RB 1..528 110..637 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:30:17 Download gff for MIP03712.complete
Subject Subject Range Query Range Percent Splice Strand
Sclp-RB 1..528 110..637 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-18 11:19:30 Download gff for MIP03712.complete
Subject Subject Range Query Range Percent Splice Strand
Sclp-RA 505..1107 173..775 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:38:48 Download gff for MIP03712.complete
Subject Subject Range Query Range Percent Splice Strand
Sclp-RB 1..770 1..770 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:17:46 Download gff for MIP03712.complete
Subject Subject Range Query Range Percent Splice Strand
Sclp-RB 1..770 1..770 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:30:17 Download gff for MIP03712.complete
Subject Subject Range Query Range Percent Splice Strand
Sclp-RB 1..770 1..770 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:15:39 Download gff for MIP03712.complete
Subject Subject Range Query Range Percent Splice Strand
X 11921640..11921931 486..777 100 <- Minus
X 11921998..11922165 318..485 100 <- Minus
X 11922230..11922373 174..317 100 <- Minus
X 11922588..11922760 1..173 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:15:39 Download gff for MIP03712.complete
Subject Subject Range Query Range Percent Splice Strand
X 11921640..11921931 486..777 100 <- Minus
X 11921998..11922165 318..485 100 <- Minus
X 11922230..11922373 174..317 100 <- Minus
X 11922588..11922760 1..173 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:15:39 Download gff for MIP03712.complete
Subject Subject Range Query Range Percent Splice Strand
X 11921640..11921931 486..777 100 <- Minus
X 11921998..11922165 318..485 100 <- Minus
X 11922230..11922373 174..317 100 <- Minus
X 11922588..11922760 1..173 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:17:46 Download gff for MIP03712.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11816263..11816406 174..317 100 <- Minus
arm_X 11816621..11816793 1..173 100   Minus
arm_X 11815673..11815964 486..777 100 <- Minus
arm_X 11816031..11816198 318..485 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:12:47 Download gff for MIP03712.complete
Subject Subject Range Query Range Percent Splice Strand
X 11930096..11930263 318..485 100 <- Minus
X 11930328..11930471 174..317 100 <- Minus
X 11930686..11930858 1..173 100   Minus
X 11929738..11930029 486..777 100 <- Minus

MIP03712.pep Sequence

Translation from 109 to 636

> MIP03712.pep
MAHLVVRVIERCENANESAHLDLSSCELMQIPDAVYHLMRNTELITCNLS
GNVLKSVSPKFSQKFSTITDLNLSHNKLSRLPEEFASLSALTKLNISNNS
FIVLPQVVFKLQSLASLDAQNNAILEIDTDEAITSDNLALVDLRNNPLSR
NCRRKLQSFKTPFHLEISKDVEDDW*

MIP03712.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21583-PA 247 GF21583-PA 74..247 2..175 703 77 Plus
Dana\GF18150-PA 782 GF18150-PA 605..732 17..146 145 34.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18819-PA 246 GG18819-PA 73..246 2..175 827 91.4 Plus
Dere\GG17029-PA 873 GG17029-PA 695..823 16..146 146 38.8 Plus
Dere\GG22967-PA 239 GG22967-PA 87..227 42..172 143 35.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:01:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11829-PA 256 GH11829-PA 83..246 5..168 662 77.4 Plus
Dgri\GH14049-PA 744 GH14049-PA 565..694 15..146 188 40 Plus
Dgri\GH21000-PA 237 GH21000-PA 70..170 28..131 153 41 Plus
Dgri\GH14049-PA 744 GH14049-PA 216..315 21..124 152 44.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
Sclp-PB 175 CG2471-PB 1..175 1..175 883 100 Plus
Sclp-PA 249 CG2471-PA 79..249 5..175 828 95.3 Plus
Sclp-PC 339 CG2471-PC 79..249 5..175 828 95.3 Plus
f-cup-PE 620 CG9611-PE 442..572 16..148 188 37.8 Plus
f-cup-PB 650 CG9611-PB 472..602 16..148 188 37.8 Plus
f-cup-PA 693 CG9611-PA 515..645 16..148 188 37.8 Plus
f-cup-PG 759 CG9611-PG 581..711 16..148 188 37.8 Plus
f-cup-PF 802 CG9611-PF 624..754 16..148 188 37.8 Plus
Lrch-PA 809 CG6860-PA 131..272 3..149 150 31.8 Plus
Lrch-PC 1079 CG6860-PC 131..272 3..149 150 31.8 Plus
Lrch-PB 1135 CG6860-PB 131..272 3..149 150 31.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:01:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14772-PA 270 GI14772-PA 97..270 2..175 717 78.7 Plus
Dmoj\GI24424-PA 694 GI24424-PA 517..644 17..146 176 39.4 Plus
Dmoj\GI20638-PA 237 GI20638-PA 98..170 59..131 144 43.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:01:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15850-PA 249 GL15850-PA 79..249 5..175 632 69.6 Plus
Dper\GL15851-PA 152 GL15851-PA 6..122 53..165 238 48.7 Plus
Dper\GL24452-PA 655 GL24452-PA 478..605 17..146 156 39.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:01:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15374-PA 249 GA15374-PA 79..249 5..175 620 68.4 Plus
Dpse\GA23495-PA 200 GA23495-PA 13..172 8..165 345 47.5 Plus
Dpse\GA23498-PA 199 GA23498-PA 13..172 8..165 343 47.5 Plus
Dpse\GA26616-PA 655 GA26616-PA 478..605 17..146 161 40.6 Plus
Dpse\GA26616-PD 616 GA26616-PD 439..566 17..146 161 40.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:01:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13238-PA 249 GM13238-PA 76..249 2..175 828 92 Plus
Dsec\GM25913-PA 898 GM25913-PA 720..848 16..146 146 38.8 Plus
Dsec\GM11861-PA 241 GM11861-PA 99..191 56..146 142 38.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:01:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15956-PA 249 GD15956-PA 76..249 2..175 828 92 Plus
Dsim\GD11859-PA 241 GD11859-PA 99..217 56..164 142 34.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:01:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18740-PA 243 GJ18740-PA 73..243 5..175 712 78.9 Plus
Dvir\GJ14282-PA 750 GJ14282-PA 573..700 17..146 167 38.6 Plus
Dvir\GJ21606-PA 237 GJ21606-PA 85..187 42..146 144 40.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:01:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10280-PA 267 GK10280-PA 97..267 5..175 718 80.1 Plus
Dwil\GK13066-PA 650 GK13066-PA 469..600 9..146 181 39.3 Plus
Dwil\GK19299-PA 163 GK19299-PA 1..113 34..146 166 40.9 Plus
Dwil\GK19345-PA 240 GK19345-PA 40..190 21..146 155 31.8 Plus
Dwil\GK13066-PA 650 GK13066-PA 112..213 19..124 144 43.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:01:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17583-PA 253 GE17583-PA 80..253 2..175 819 90.2 Plus

MIP03712.hyp Sequence

Translation from 109 to 636

> MIP03712.hyp
MAHLVVRVIERCENANESAHLDLSSCELMQIPDAVYHLMRNTELITCNLS
GNVLKSVSPKFSQKFSTITDLNLSHNKLSRLPEEFASLSALTKLNISNNS
FIVLPQVVFKLQSLASLDAQNNAILEIDTDEAITSDNLALVDLRNNPLSR
NCRRKLQSFKTPFHLEISKDVEDDW*

MIP03712.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
Sclp-PB 175 CG2471-PB 1..175 1..175 883 100 Plus
Sclp-PA 249 CG2471-PA 79..249 5..175 828 95.3 Plus
Sclp-PC 339 CG2471-PC 79..249 5..175 828 95.3 Plus
f-cup-PE 620 CG9611-PE 442..572 16..148 188 37.8 Plus
f-cup-PB 650 CG9611-PB 472..602 16..148 188 37.8 Plus