Clone MIP03955 Report

Search the DGRC for MIP03955

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:39
Well:55
Vector:pOT2
Associated Gene/TranscriptCG42361-RA
Protein status:MIP03955.pep: gold
Sequenced Size:980

Clone Sequence Records

MIP03955.complete Sequence

980 bp assembled on 2009-05-14

GenBank Submission: BT058068.1

> MIP03955.complete
AGCCAACTGAATCACTGCTGCCGAAATCAGCAAGTCCGAATCCAAGAGGC
CAAAGTATCACCTACAACCCACCAAGTATGGAGAAGATCTGGAAGAAGGT
GTGCGAGCACCACGATGTGCCCGAGCAGGTGGCCAACGAGTGGTTCGCCC
GCATTCAGCAGCACCTGAGCTCCGAGGATCCCGCTCGCGCCTACCACAAT
TGGGAGGAGATGATGCGGCGCAAGGAGCCGCACTTGGCGGGCGTGGCCAA
TCCCAACATTGTGCTGGCCGCCTTCTTCCAGTACTACCACTTCGATGGTA
ACCGCAGCTGTGCGGAGAAGAACTGCGAGGTCTTTGAGGAGTTTTGCAAT
GATGCCGTCATCGAGGATGACCATGCAAAAAGCCTGGTATGTAATTTGCT
GGGGCGCAAGACCCCGGAGAACCAGTTGACCTGGTGCCATGACGACGAGG
CCAACTTGCTGCAGGACGTAGACCTGGTGGTCCTAGCTGCTTCGCCGGAG
GAGTACAAGCACTATACAACTCTCCTTCGCTCGGAGTACGCCAATCTCGA
CGATGCCACCTACAAGGCCATGCGCATCAAGGTGCTGGAGACCCTGCTGA
TGATTCCCTCCATCTACGCCACTGGAGACTACCACGACAAGTACGAAGAG
CTAGCCCGCGCCAACATACGCAACGAGATCAGCGAGCTGAAGAAGCAGTA
AATCAGAGTTGGAGGACCAGGATGTAACGGGGCTGCTTTGTTTACTGCTG
TTGAGTTGTGTACTTACTGGCCGTTTTACCTCGGTTGACTGCAAGGCACT
CGTGTATTGGTTGAGCAACCTTCTCTGCCGAACATCTACTTAATTTTACT
CCTAAGTGAAGTGTAATCAAAATCATTTTCCTAGTTAGTGTGTACGCCTA
GATATATACGTAAGCCCTGTAAACTCCAGCTCAGAATAAAATTGATGTAA
ATGATGTAACAAAAAAAAAAAAAAAAAAAA

MIP03955.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:22:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG42361-RA 1039 CG42361-RA 69..1033 1..965 4810 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20494197..20494669 488..960 2365 100 Plus
chr2R 21145070 chr2R 20493595..20493963 1..369 1830 99.7 Plus
chr2R 21145070 chr2R 20494021..20494139 369..487 595 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:02:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:09:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24608319..24608796 488..965 2375 99.8 Plus
2R 25286936 2R 24607717..24608085 1..369 1845 100 Plus
2R 25286936 2R 24608143..24608261 369..487 595 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24609518..24609995 488..965 2375 99.7 Plus
2R 25260384 2R 24608916..24609284 1..369 1845 100 Plus
2R 25260384 2R 24609342..24609460 369..487 595 100 Plus
Blast to na_te.dros performed on 2019-03-15 17:09:24 has no hits.

MIP03955.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:10:08 Download gff for MIP03955.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20493595..20493962 1..368 99 -> Plus
chr2R 20494021..20494139 369..487 100 -> Plus
chr2R 20494197..20494669 488..960 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:09 Download gff for MIP03955.complete
Subject Subject Range Query Range Percent Splice Strand
CG42361-RA 1..624 78..701 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:34:01 Download gff for MIP03955.complete
Subject Subject Range Query Range Percent Splice Strand
CG42361-RA 1..624 78..701 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:16:23 Download gff for MIP03955.complete
Subject Subject Range Query Range Percent Splice Strand
CG42361-RA 1..624 78..701 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:27:39 Download gff for MIP03955.complete
Subject Subject Range Query Range Percent Splice Strand
CG42361-RA 1..624 78..701 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-05 15:49:16 Download gff for MIP03955.complete
Subject Subject Range Query Range Percent Splice Strand
CG42361-RA 25..725 1..701 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:34:01 Download gff for MIP03955.complete
Subject Subject Range Query Range Percent Splice Strand
CG42361-RA 25..981 1..957 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:16:23 Download gff for MIP03955.complete
Subject Subject Range Query Range Percent Splice Strand
CG42361-RA 45..1001 1..957 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:27:39 Download gff for MIP03955.complete
Subject Subject Range Query Range Percent Splice Strand
CG42361-RA 45..1001 1..957 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:10:08 Download gff for MIP03955.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24607717..24608084 1..368 100 -> Plus
2R 24608143..24608261 369..487 100 -> Plus
2R 24608319..24608791 488..960 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:10:08 Download gff for MIP03955.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24607717..24608084 1..368 100 -> Plus
2R 24608143..24608261 369..487 100 -> Plus
2R 24608319..24608791 488..960 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:10:08 Download gff for MIP03955.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24607717..24608084 1..368 100 -> Plus
2R 24608143..24608261 369..487 100 -> Plus
2R 24608319..24608791 488..960 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:16:23 Download gff for MIP03955.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20495240..20495607 1..368 100 -> Plus
arm_2R 20495666..20495784 369..487 100 -> Plus
arm_2R 20495842..20496314 488..960 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:07:20 Download gff for MIP03955.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24608934..24609301 1..368 100 -> Plus
2R 24609360..24609478 369..487 100 -> Plus
2R 24609536..24610008 488..960 100   Plus

MIP03955.hyp Sequence

Translation from 2 to 700

> MIP03955.hyp
PTESLLPKSASPNPRGQSITYNPPSMEKIWKKVCEHHDVPEQVANEWFAR
IQQHLSSEDPARAYHNWEEMMRRKEPHLAGVANPNIVLAAFFQYYHFDGN
RSCAEKNCEVFEEFCNDAVIEDDHAKSLVCNLLGRKTPENQLTWCHDDEA
NLLQDVDLVVLAASPEEYKHYTTLLRSEYANLDDATYKAMRIKVLETLLM
IPSIYATGDYHDKYEELARANIRNEISELKKQ*

MIP03955.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG42361-PA 207 CG3579-PA 1..207 26..232 1116 100 Plus

MIP03955.pep Sequence

Translation from 2 to 700

> MIP03955.pep
PTESLLPKSASPNPRGQSITYNPPSMEKIWKKVCEHHDVPEQVANEWFAR
IQQHLSSEDPARAYHNWEEMMRRKEPHLAGVANPNIVLAAFFQYYHFDGN
RSCAEKNCEVFEEFCNDAVIEDDHAKSLVCNLLGRKTPENQLTWCHDDEA
NLLQDVDLVVLAASPEEYKHYTTLLRSEYANLDDATYKAMRIKVLETLLM
IPSIYATGDYHDKYEELARANIRNEISELKKQ*

MIP03955.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12994-PA 159 GF12994-PA 49..158 123..232 500 87.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22992-PA 156 GG22992-PA 47..156 123..232 573 98.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:39:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20322-PA 208 GH20322-PA 1..205 26..231 850 74.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG42361-PA 207 CG3579-PA 1..207 26..232 1116 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:39:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19994-PA 206 GI19994-PA 1..206 26..232 865 74.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10230-PA 206 GL10230-PA 1..206 26..231 956 84 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:39:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24128-PA 206 GA24128-PA 1..206 26..231 959 84.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:39:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11885-PA 307 GM11885-PA 76..307 1..232 1253 99.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11883-PA 462 GD11883-PA 76..306 1..231 1254 100 Plus
Dsim\GD11883-PA 462 GD11883-PA 280..462 48..232 775 82.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21243-PA 205 GJ21243-PA 1..205 26..231 868 76.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21420-PA 218 GK21420-PA 1..217 26..232 755 64.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14429-PA 307 GE14429-PA 76..307 1..232 1237 97.8 Plus