MIP04089.complete Sequence
683 bp assembled on 2009-10-02
GenBank Submission: BT082004.1
> MIP04089.complete
AACATACCAAACAATCATCGAAATCAATAAAAGCCATGGAGGATGACTTG
GAGTTTCTTATCAACGCCCTGTCGGTGCCAAACACTCCACTCACCGAACC
CTACGATGAGGGGCAACTTCTAGAGATGCGTGAATCCTTCAAGACGCTGC
AGAAGCTCCTGCGGCGCAGTTCGCTGCCCGTAGAGGAGAGTCTGCGTTCC
ATGCCGAGATCGAAAGCTGGAGGTCAACTGGAGGCATTGCCATCCTTGCT
GCCTATTGTGGACAACAATTACGAGAGGACCAGCGATAAGGCGTGGAACT
CGGCGGAAAGCGGAGCCCGTTCGTCGCCCATCATTTCGGAGTGCGGCCTG
GGTGATTGGGATAAGGAGGATCCTTCAGATCCTTCAGATAGGGCACTGGT
GCCCTACGAGGAACTGGGCAATGAGCGAAGCAGTTCGGACACCACAATCA
CCAGCCGTAGCTTCGCATCGTCGGGAATCTCGCTCAGCATACCTGTTCAC
TTGGTATGGAACAACAAAGAGTACAATCAGGAGAGCACGGACAGTGAAAC
TACACTTATAGCGGACGGGCGCAGATACAGTATTACAAATTAGGCCACAT
AGTATTTTTCAAAATTATAGTAAGCGGATTGAAGTTTCATACATATTTAA
TAAATGGTGAATAACAAAAAAAAAAAAAAAAAA
MIP04089.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:29:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6138-RA | 724 | CG6138-RA | 59..724 | 1..666 | 3330 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:57:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 10566156..10566820 | 1..665 | 3325 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:02:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:57:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 10567348..10568013 | 1..666 | 3330 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 10567348..10568013 | 1..666 | 3330 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 13:57:45 has no hits.
MIP04089.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:58:39 Download gff for
MIP04089.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 10566156..10566820 | 1..665 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:43 Download gff for
MIP04089.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6138-RA | 1..558 | 36..593 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:44:29 Download gff for
MIP04089.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6138-RA | 1..558 | 36..593 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:31:42 Download gff for
MIP04089.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6138-RA | 1..558 | 36..593 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:26:30 Download gff for
MIP04089.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6138-RA | 1..558 | 36..593 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-02 11:36:17 Download gff for
MIP04089.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6138-RA | 59..723 | 1..665 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:44:29 Download gff for
MIP04089.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6138-RA | 59..723 | 1..665 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:31:42 Download gff for
MIP04089.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6138-RA | 94..758 | 1..665 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:26:30 Download gff for
MIP04089.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6138-RA | 94..758 | 1..665 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:39 Download gff for
MIP04089.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10567348..10568012 | 1..665 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:39 Download gff for
MIP04089.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10567348..10568012 | 1..665 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:39 Download gff for
MIP04089.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10567348..10568012 | 1..665 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:31:42 Download gff for
MIP04089.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 10567348..10568012 | 1..665 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:19:36 Download gff for
MIP04089.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10567348..10568012 | 1..665 | 100 | | Plus |
MIP04089.hyp Sequence
Translation from 2 to 592
> MIP04089.hyp
HTKQSSKSIKAMEDDLEFLINALSVPNTPLTEPYDEGQLLEMRESFKTLQ
KLLRRSSLPVEESLRSMPRSKAGGQLEALPSLLPIVDNNYERTSDKAWNS
AESGARSSPIISECGLGDWDKEDPSDPSDRALVPYEELGNERSSSDTTIT
SRSFASSGISLSIPVHLVWNNKEYNQESTDSETTLIADGRRYSITN*
MIP04089.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:30:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6138-PA | 185 | CG6138-PA | 1..185 | 12..196 | 946 | 100 | Plus |
MIP04089.pep Sequence
Translation from 2 to 592
> MIP04089.pep
HTKQSSKSIKAMEDDLEFLINALSVPNTPLTEPYDEGQLLEMRESFKTLQ
KLLRRSSLPVEESLRSMPRSKAGGQLEALPSLLPIVDNNYERTSDKAWNS
AESGARSSPIISECGLGDWDKEDPSDPSDRALVPYEELGNERSSSDTTIT
SRSFASSGISLSIPVHLVWNNKEYNQESTDSETTLIADGRRYSITN*
MIP04089.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:21:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF15806-PA | 284 | GF15806-PA | 1..209 | 12..196 | 458 | 51.9 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:21:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23653-PA | 217 | GG23653-PA | 1..182 | 12..191 | 744 | 81.3 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:21:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH10416-PA | 228 | GH10416-PA | 1..228 | 12..196 | 215 | 32.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6138-PA | 185 | CG6138-PA | 1..185 | 12..196 | 946 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:21:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL26616-PA | 188 | GL26616-PA | 1..186 | 12..194 | 178 | 33.7 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:21:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18582-PA | 186 | GM18582-PA | 1..186 | 12..196 | 864 | 89.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:21:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23717-PA | 600 | GD23717-PA | 1..145 | 12..155 | 664 | 89 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:21:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK14606-PA | 189 | GK14606-PA | 1..185 | 12..192 | 216 | 40.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:21:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18472-PA | 186 | GE18472-PA | 1..184 | 12..194 | 769 | 82.6 | Plus |