Clone MIP04089 Report

Search the DGRC for MIP04089

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:40
Well:89
Vector:pOT2
Associated Gene/TranscriptCG6138-RA
Protein status:MIP04089.pep: gold
Sequenced Size:683

Clone Sequence Records

MIP04089.complete Sequence

683 bp assembled on 2009-10-02

GenBank Submission: BT082004.1

> MIP04089.complete
AACATACCAAACAATCATCGAAATCAATAAAAGCCATGGAGGATGACTTG
GAGTTTCTTATCAACGCCCTGTCGGTGCCAAACACTCCACTCACCGAACC
CTACGATGAGGGGCAACTTCTAGAGATGCGTGAATCCTTCAAGACGCTGC
AGAAGCTCCTGCGGCGCAGTTCGCTGCCCGTAGAGGAGAGTCTGCGTTCC
ATGCCGAGATCGAAAGCTGGAGGTCAACTGGAGGCATTGCCATCCTTGCT
GCCTATTGTGGACAACAATTACGAGAGGACCAGCGATAAGGCGTGGAACT
CGGCGGAAAGCGGAGCCCGTTCGTCGCCCATCATTTCGGAGTGCGGCCTG
GGTGATTGGGATAAGGAGGATCCTTCAGATCCTTCAGATAGGGCACTGGT
GCCCTACGAGGAACTGGGCAATGAGCGAAGCAGTTCGGACACCACAATCA
CCAGCCGTAGCTTCGCATCGTCGGGAATCTCGCTCAGCATACCTGTTCAC
TTGGTATGGAACAACAAAGAGTACAATCAGGAGAGCACGGACAGTGAAAC
TACACTTATAGCGGACGGGCGCAGATACAGTATTACAAATTAGGCCACAT
AGTATTTTTCAAAATTATAGTAAGCGGATTGAAGTTTCATACATATTTAA
TAAATGGTGAATAACAAAAAAAAAAAAAAAAAA

MIP04089.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG6138-RA 724 CG6138-RA 59..724 1..666 3330 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:57:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10566156..10566820 1..665 3325 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:02:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:57:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10567348..10568013 1..666 3330 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10567348..10568013 1..666 3330 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:57:45 has no hits.

MIP04089.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:58:39 Download gff for MIP04089.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10566156..10566820 1..665 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:43 Download gff for MIP04089.complete
Subject Subject Range Query Range Percent Splice Strand
CG6138-RA 1..558 36..593 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:44:29 Download gff for MIP04089.complete
Subject Subject Range Query Range Percent Splice Strand
CG6138-RA 1..558 36..593 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:31:42 Download gff for MIP04089.complete
Subject Subject Range Query Range Percent Splice Strand
CG6138-RA 1..558 36..593 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:26:30 Download gff for MIP04089.complete
Subject Subject Range Query Range Percent Splice Strand
CG6138-RA 1..558 36..593 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-02 11:36:17 Download gff for MIP04089.complete
Subject Subject Range Query Range Percent Splice Strand
CG6138-RA 59..723 1..665 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:44:29 Download gff for MIP04089.complete
Subject Subject Range Query Range Percent Splice Strand
CG6138-RA 59..723 1..665 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:31:42 Download gff for MIP04089.complete
Subject Subject Range Query Range Percent Splice Strand
CG6138-RA 94..758 1..665 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:26:30 Download gff for MIP04089.complete
Subject Subject Range Query Range Percent Splice Strand
CG6138-RA 94..758 1..665 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:39 Download gff for MIP04089.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10567348..10568012 1..665 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:39 Download gff for MIP04089.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10567348..10568012 1..665 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:58:39 Download gff for MIP04089.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10567348..10568012 1..665 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:31:42 Download gff for MIP04089.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10567348..10568012 1..665 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:19:36 Download gff for MIP04089.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10567348..10568012 1..665 100   Plus

MIP04089.hyp Sequence

Translation from 2 to 592

> MIP04089.hyp
HTKQSSKSIKAMEDDLEFLINALSVPNTPLTEPYDEGQLLEMRESFKTLQ
KLLRRSSLPVEESLRSMPRSKAGGQLEALPSLLPIVDNNYERTSDKAWNS
AESGARSSPIISECGLGDWDKEDPSDPSDRALVPYEELGNERSSSDTTIT
SRSFASSGISLSIPVHLVWNNKEYNQESTDSETTLIADGRRYSITN*

MIP04089.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG6138-PA 185 CG6138-PA 1..185 12..196 946 100 Plus

MIP04089.pep Sequence

Translation from 2 to 592

> MIP04089.pep
HTKQSSKSIKAMEDDLEFLINALSVPNTPLTEPYDEGQLLEMRESFKTLQ
KLLRRSSLPVEESLRSMPRSKAGGQLEALPSLLPIVDNNYERTSDKAWNS
AESGARSSPIISECGLGDWDKEDPSDPSDRALVPYEELGNERSSSDTTIT
SRSFASSGISLSIPVHLVWNNKEYNQESTDSETTLIADGRRYSITN*

MIP04089.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:21:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15806-PA 284 GF15806-PA 1..209 12..196 458 51.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:21:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23653-PA 217 GG23653-PA 1..182 12..191 744 81.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:21:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10416-PA 228 GH10416-PA 1..228 12..196 215 32.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG6138-PA 185 CG6138-PA 1..185 12..196 946 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:21:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26616-PA 188 GL26616-PA 1..186 12..194 178 33.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:21:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18582-PA 186 GM18582-PA 1..186 12..196 864 89.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:21:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23717-PA 600 GD23717-PA 1..145 12..155 664 89 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:21:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14606-PA 189 GK14606-PA 1..185 12..192 216 40.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:21:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18472-PA 186 GE18472-PA 1..184 12..194 769 82.6 Plus