Clone MIP04133 Report

Search the DGRC for MIP04133

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:41
Well:33
Vector:pOT2
Associated Gene/TranscriptCG33493-RA
Protein status:MIP04133.pep: gold
Sequenced Size:582

Clone Sequence Records

MIP04133.complete Sequence

582 bp assembled on 2011-03-07

GenBank Submission: BT126248.1

> MIP04133.complete
CTCAGTTCGTTTTCAACATGCGTGCGCTTCAGTACCTTCTGCTACTGCTC
GTCATCTCCATCGGCTTGGCGGCATCGGTGCCTCGCCAGCGTCGTCAGAT
CGATCTCACGGTTTCGGCGGAGCACGACGACAACGATGAGGAGACGGAAC
TGGCTCTGGAGGCCATCGCCGGGCTATGGAGCAGTGCGGACAGTCGGACG
AAGATCGATGGCTCTGCCAGCCTGGTGCATCGAACACATGGAACACAATC
GGGTACGGGCAGCACCAGATACCAGGCCAAACTGCATCTACACCATGACT
ATAAGACCAATGCGTATCCCTCGTAATCCAAGGTTCGGAGCAGGACTTTC
GCGTGGGCGTGCGTATTACATTCGACAAATAGAGCCGTGAGAATTCCAGA
CATCAGCAGGCGGGCGGCCGGGGACAAAATCGAGCGATTGCGTGAGGAGA
CAGACGGCCACTGTATAAACAATCCCACTGACGATAGATAACATTTTGAC
CTTCTCGGGCTTGGCTTTGTTGGAAATATATATAGAACGTTTGTGAAAAT
ACAATATACCCGCATAAAAAAAAAAAAAAAAA

MIP04133.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:18:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10683866..10684430 565..1 2795 99.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10692574..10693140 567..1 2835 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10685674..10686240 567..1 2835 100 Minus
Blast to na_te.dros performed on 2019-03-16 22:18:58 has no hits.

MIP04133.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:19:40 Download gff for MIP04133.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10683866..10684430 1..565 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-07 17:59:59 Download gff for MIP04133.complete
Subject Subject Range Query Range Percent Splice Strand
CG33493-RA 1..309 18..326 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:54:03 Download gff for MIP04133.complete
Subject Subject Range Query Range Percent Splice Strand
CG33493-RA 1..309 18..326 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:26:30 Download gff for MIP04133.complete
Subject Subject Range Query Range Percent Splice Strand
CG33493-RA 1..309 18..326 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-07 17:59:59 Download gff for MIP04133.complete
Subject Subject Range Query Range Percent Splice Strand
CG33493-RA 1..321 6..326 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:54:03 Download gff for MIP04133.complete
Subject Subject Range Query Range Percent Splice Strand
CG33493-RA 28..592 1..565 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:26:30 Download gff for MIP04133.complete
Subject Subject Range Query Range Percent Splice Strand
CG33493-RA 28..592 1..565 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:40 Download gff for MIP04133.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10692576..10693140 1..565 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:40 Download gff for MIP04133.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10692576..10693140 1..565 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:19:40 Download gff for MIP04133.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10692576..10693140 1..565 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:54:03 Download gff for MIP04133.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10685676..10686240 1..565 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:50 Download gff for MIP04133.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10685676..10686240 1..565 100   Minus

MIP04133.hyp Sequence

Translation from 0 to 389

> MIP04133.hyp
LSSFSTCVRFSTFCYCSSSPSAWRHRCLASVVRSISRFRRSTTTTMRRRN
WLWRPSPGYGAVRTVGRRSMALPAWCIEHMEHNRVRAAPDTRPNCIYTMT
IRPMRIPRNPRFGAGLSRGRAYYIRQIEP*
Sequence MIP04133.hyp has no blast hits.

MIP04133.pep Sequence

Translation from 2 to 325

> MIP04133.pep
QFVFNMRALQYLLLLLVISIGLAASVPRQRRQIDLTVSAEHDDNDEETEL
ALEAIAGLWSSADSRTKIDGSASLVHRTHGTQSGTGSTRYQAKLHLHHDY
KTNAYPS*

MIP04133.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23823-PA 109 GF23823-PA 1..107 6..107 364 75.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13965-PA 102 GG13965-PA 1..102 6..107 478 95.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15572-PA 102 GH15572-PA 1..100 6..105 346 68 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG33493-PA 102 CG33493-PA 1..102 6..107 516 100 Plus
CG33493-PB 94 CG33493-PB 1..80 6..85 388 98.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:02:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16847-PA 105 GI16847-PA 24..103 19..105 307 72.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20741-PA 104 GL20741-PA 1..104 6..107 379 76 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28304-PA 104 GA28304-PA 1..104 6..107 379 76 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24802-PA 102 GM24802-PA 1..102 6..107 526 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12854-PA 102 GD12854-PA 1..102 6..107 523 98 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12597-PA 104 GJ12597-PA 1..102 6..105 367 70.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16794-PA 116 GK16794-PA 1..116 6..104 360 62.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20263-PA 102 GE20263-PA 1..102 6..107 481 96.1 Plus