Clone MIP04239 Report

Search the DGRC for MIP04239

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:42
Well:39
Vector:pOT2
Associated Gene/TranscriptCG11839-RB
Protein status:MIP04239.pep: gold
Sequenced Size:853

Clone Sequence Records

MIP04239.complete Sequence

853 bp assembled on 2009-02-05

GenBank Submission: BT058075.1

> MIP04239.complete
AGAAGCCGCTGAAAAACCTAAGAATATTGAAAATCAACATGAATAATGGG
AATATAAAACGCCTTCAAAAGAAACTCAGCGTTTCGAAAAAGCCAGCAGT
CACTGTGGATTCACCATTGGCAAAGTATGACTCCTCGGGCATCTTGACCT
GCATTATTTGCAGGATTCCTATCAAACCCAACGTCTGGAAGGTGCATATA
AATTCCAAGCAGCACAAACTGAACGTCGATCAGGCTAAGCAGAATAAGGT
GGAGAAACCCGTCACCACTACTGCACCCAAGGATCCTACGGGTCCGTCCA
CCAAGACTTCAGCTCCTGCCAAAAACTCCAGCACACTGCCAGATAAAACT
CCACAGAGCAGCCAGGAAAAGCATCCTCCCCTCATTCAAGAGAAAACTGC
CCAGGGAAATGCGAGCAGCAAGCCTGAGAATGAAACTACTGTCGAGAAAC
TGCCAGAAAAGTTCTTCGACGAGGATAAGACCAATAAATCGGAGGCCGCT
CGCCTTCAGGACGAGGAATGGCAGCGATTCCAGCAGGAGATCAAGCGGGC
GGACACGGAATCCAGTGAAATTGTGGCCGACGAGCAGGAGGACATCAATC
TCAAGCGACACATCAAGGAGATCGACGAGCAGATCGACAACTGGAAGAGA
TTTATTAAAATTAACGATCAGAAAAAAGTACTCCTTAGTAAAAAGCGAAG
AGTAGACCCCAAGATGGAGGTCGATCCGGAATTGAGTTCAAGCGAAGAAG
ATTGCAGTGTGGATGATTTGTTCGACTGGAGAACGAAAAATCTGCATAGC
TAGAGAATAAATATGGTATTAAAATGTTACTGTTATAAAAAAAAAAAAAA
AAA

MIP04239.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG11839.a 978 CG11839.a 121..967 1..847 4205 99.7 Plus
CG11839-RA 768 CG11839-RA 90..768 125..803 3395 100 Plus
CG11839-RA 768 CG11839-RA 1..60 39..98 300 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:40:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20893375..20894086 125..836 3425 98.7 Plus
chr3R 27901430 chr3R 20893099..20893226 1..128 625 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:02:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:40:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25070203..25070925 125..847 3585 99.7 Plus
3R 32079331 3R 25069927..25070054 1..128 625 99.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24811034..24811756 125..847 3585 99.7 Plus
3R 31820162 3R 24810758..24810885 1..128 625 99.2 Plus
Blast to na_te.dros performed on 2019-03-15 23:40:19 has no hits.

MIP04239.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:40:58 Download gff for MIP04239.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20893099..20893222 1..124 100 <- Plus
chr3R 20893375..20894086 125..836 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:13 Download gff for MIP04239.complete
Subject Subject Range Query Range Percent Splice Strand
CG11839-RA 1..768 39..803 97   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:34:05 Download gff for MIP04239.complete
Subject Subject Range Query Range Percent Splice Strand
CG11839-RB 1..765 39..803 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:30:32 Download gff for MIP04239.complete
Subject Subject Range Query Range Percent Splice Strand
CG11839-RB 1..765 39..803 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:45:25 Download gff for MIP04239.complete
Subject Subject Range Query Range Percent Splice Strand
CG11839-RB 1..765 39..803 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-05 16:40:03 Download gff for MIP04239.complete
Subject Subject Range Query Range Percent Splice Strand
CG11839-RA 1..768 39..803 97   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:34:05 Download gff for MIP04239.complete
Subject Subject Range Query Range Percent Splice Strand
CG11839-RB 1..836 1..836 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:30:32 Download gff for MIP04239.complete
Subject Subject Range Query Range Percent Splice Strand
CG11839-RB 1..836 1..836 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:45:25 Download gff for MIP04239.complete
Subject Subject Range Query Range Percent Splice Strand
CG11839-RB 1..836 1..836 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:40:58 Download gff for MIP04239.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25069927..25070050 1..124 100 <- Plus
3R 25070203..25070914 125..836 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:40:58 Download gff for MIP04239.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25069927..25070050 1..124 100 <- Plus
3R 25070203..25070914 125..836 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:40:58 Download gff for MIP04239.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25069927..25070050 1..124 100 <- Plus
3R 25070203..25070914 125..836 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:30:32 Download gff for MIP04239.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20895649..20895772 1..124 100 <- Plus
arm_3R 20895925..20896636 125..836 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:07:24 Download gff for MIP04239.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24811034..24811745 125..836 100   Plus
3R 24810758..24810881 1..124 100 <- Plus

MIP04239.hyp Sequence

Translation from 2 to 802

> MIP04239.hyp
KPLKNLRILKINMNNGNIKRLQKKLSVSKKPAVTVDSPLAKYDSSGILTC
IICRIPIKPNVWKVHINSKQHKLNVDQAKQNKVEKPVTTTAPKDPTGPST
KTSAPAKNSSTLPDKTPQSSQEKHPPLIQEKTAQGNASSKPENETTVEKL
PEKFFDEDKTNKSEAARLQDEEWQRFQQEIKRADTESSEIVADEQEDINL
KRHIKEIDEQIDNWKRFIKINDQKKVLLSKKRRVDPKMEVDPELSSSEED
CSVDDLFDWRTKNLHS*

MIP04239.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:27:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG11839-PB 254 CG11839-PB 1..254 13..266 1321 100 Plus

MIP04239.pep Sequence

Translation from 2 to 802

> MIP04239.pep
KPLKNLRILKINMNNGNIKRLQKKLSVSKKPAVTVDSPLAKYDSSGILTC
IICRIPIKPNVWKVHINSKQHKLNVDQAKQNKVEKPVTTTAPKDPTGPST
KTSAPAKNSSTLPDKTPQSSQEKHPPLIQEKTAQGNASSKPENETTVEKL
PEKFFDEDKTNKSEAARLQDEEWQRFQQEIKRADTESSEIVADEQEDINL
KRHIKEIDEQIDNWKRFIKINDQKKVLLSKKRRVDPKMEVDPELSSSEED
CSVDDLFDWRTKNLHS*

MIP04239.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17885-PA 257 GF17885-PA 1..257 13..266 824 66.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:39:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11356-PA 257 GG11356-PA 1..256 13..265 1093 86.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19584-PA 232 GH19584-PA 15..231 42..265 473 44.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG11839-PB 254 CG11839-PB 1..254 13..266 1321 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:39:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20509-PA 199 GL20509-PA 2..199 42..266 518 52.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:39:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11226-PA 199 GA11226-PA 2..199 42..266 515 52.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17796-PA 243 GM17796-PA 1..226 13..237 1019 88.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21168-PA 255 GD21168-PA 1..255 13..266 1146 89.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13881-PA 220 GK13881-PA 2..219 42..265 454 48 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23553-PA 248 GE23553-PA 1..247 13..265 1148 88.5 Plus