Clone MIP04282 Report

Search the DGRC for MIP04282

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:42
Well:82
Vector:pOT2
Associated Gene/TranscriptCG13510-RA
Protein status:MIP04282.pep: gold
Sequenced Size:589

Clone Sequence Records

MIP04282.complete Sequence

589 bp assembled on 2009-04-30

GenBank Submission: BT082109.1

> MIP04282.complete
AGCCAGCAAAGCGATCGGTTCAGTTCGGCCGGAAATCCAGAGTCTGCATC
AAGAAGAAACATAATCCGAAACTATGGACAGCAAGCAGCCTCCACCGTAC
AGTGAACAGTCCGGATACACTCCCGCACAAACCTATCAGCCCGGTGGCCC
CACCCAGCCACCACTGTACCCACCGATGCCGCAGCCACCGCAGTCCTCAA
CGGTGATCATCCAGACCACCACAACCTCCAACCTGGTGCCCATCGGCAGT
GGACCCACCCGCATCCGCTGTCCCTCCTGTCACGCCGAAGTACTGACCAC
CGTGAAGTCCACTCCTTCCGGCAGGACGCACTGCTGGGCCCTCATCCTGT
GCCTGTTCATCTGCTGGCCGTGCGTATGCCTACCTTACTGCATGGACTCC
TGCCAGAATGCCAACCACTACTGCCCCAACTGCAGCGCCTACATCGGCAC
CTACGAGAACTAACTAACTAACGCCTATTTATGCATACAAACGTATATAC
CTATAGAGAACCCTAAGCACTAGCGTCATAACCGAGAAAAATTGAACTGT
AAATACACATGTACGAACGCCAAAAAAAAAAAAAAAAAA

MIP04282.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13510-RA 985 CG13510-RA 125..696 1..572 2860 100 Plus
CG13510.a 974 CG13510.a 324..895 1..572 2860 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18544480..18544839 1..360 1785 99.7 Plus
chr2R 21145070 chr2R 18545487..18545696 361..570 1005 98.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22657916..22658275 1..360 1800 100 Plus
2R 25286936 2R 22658923..22659134 361..572 1060 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22659115..22659474 1..360 1800 100 Plus
2R 25260384 2R 22660122..22660333 361..572 1060 100 Plus
2R 25260384 2R 22665399..22665475 386..462 145 79.2 Plus
Blast to na_te.dros performed on 2019-03-15 20:50:12 has no hits.

MIP04282.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:50:59 Download gff for MIP04282.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18544480..18544839 1..360 99 -> Plus
chr2R 18545487..18545696 361..571 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:51:23 Download gff for MIP04282.complete
Subject Subject Range Query Range Percent Splice Strand
CG13510-RA 1..390 74..463 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:49:58 Download gff for MIP04282.complete
Subject Subject Range Query Range Percent Splice Strand
CG13510-RA 1..390 74..463 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:25:07 Download gff for MIP04282.complete
Subject Subject Range Query Range Percent Splice Strand
CG13510-RA 1..390 74..463 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:32:11 Download gff for MIP04282.complete
Subject Subject Range Query Range Percent Splice Strand
CG13510-RA 1..390 74..463 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-30 09:55:58 Download gff for MIP04282.complete
Subject Subject Range Query Range Percent Splice Strand
CG13510-RA 12..582 1..571 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:49:58 Download gff for MIP04282.complete
Subject Subject Range Query Range Percent Splice Strand
CG13510-RA 12..582 1..571 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:25:07 Download gff for MIP04282.complete
Subject Subject Range Query Range Percent Splice Strand
CG13510-RA 16..586 1..571 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:32:11 Download gff for MIP04282.complete
Subject Subject Range Query Range Percent Splice Strand
CG13510-RC 16..586 1..571 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:50:59 Download gff for MIP04282.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22657916..22658275 1..360 100 -> Plus
2R 22658923..22659133 361..571 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:50:59 Download gff for MIP04282.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22657916..22658275 1..360 100 -> Plus
2R 22658923..22659133 361..571 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:50:59 Download gff for MIP04282.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22657916..22658275 1..360 100 -> Plus
2R 22658923..22659133 361..571 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:25:07 Download gff for MIP04282.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18545421..18545780 1..360 100 -> Plus
arm_2R 18546428..18546638 361..571 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:40:51 Download gff for MIP04282.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22659115..22659474 1..360 100 -> Plus
2R 22660122..22660332 361..571 100   Plus

MIP04282.hyp Sequence

Translation from 73 to 462

> MIP04282.hyp
MDSKQPPPYSEQSGYTPAQTYQPGGPTQPPLYPPMPQPPQSSTVIIQTTT
TSNLVPIGSGPTRIRCPSCHAEVLTTVKSTPSGRTHCWALILCLFICWPC
VCLPYCMDSCQNANHYCPNCSAYIGTYEN*

MIP04282.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:07:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG13510-PC 129 CG13510-PC 1..129 1..129 745 100 Plus
CG13510-PB 129 CG13510-PB 1..129 1..129 745 100 Plus
CG13510-PA 129 CG13510-PA 1..129 1..129 745 100 Plus
CG30273-PB 128 CG30273-PB 16..127 4..129 263 41.3 Plus
CG30269-PB 144 CG30269-PB 33..142 7..128 254 41.8 Plus

MIP04282.pep Sequence

Translation from 73 to 462

> MIP04282.pep
MDSKQPPPYSEQSGYTPAQTYQPGGPTQPPLYPPMPQPPQSSTVIIQTTT
TSNLVPIGSGPTRIRCPSCHAEVLTTVKSTPSGRTHCWALILCLFICWPC
VCLPYCMDSCQNANHYCPNCSAYIGTYEN*

MIP04282.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 15:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11281-PA 129 GF11281-PA 1..129 1..129 648 96.9 Plus
Dana\GF11636-PA 142 GF11636-PA 68..141 56..129 209 52.7 Plus
Dana\GF11635-PA 127 GF11635-PA 43..126 43..129 208 47.1 Plus
Dana\GF11282-PA 113 GF11282-PA 13..112 38..128 187 38 Plus
Dana\GF24273-PA 125 GF24273-PA 40..125 45..129 181 40.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 15:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21061-PA 129 GG21061-PA 1..129 1..129 652 96.9 Plus
Dere\GG22779-PA 128 GG22779-PA 19..127 6..129 233 42.7 Plus
Dere\GG22780-PA 150 GG22780-PA 76..149 56..129 201 51.4 Plus
Dere\GG14910-PA 130 GG14910-PA 18..130 4..129 184 37 Plus
Dere\GG21064-PA 113 GG21064-PA 41..113 57..129 181 46.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 15:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19761-PA 135 GH19761-PA 1..135 1..129 502 86.7 Plus
Dgri\GH19762-PA 102 GH19762-PA 4..102 14..129 411 69 Plus
Dgri\GH19763-PA 193 GH19763-PA 1..193 1..129 258 37.8 Plus
Dgri\GH19768-PA 137 GH19768-PA 11..136 14..129 227 39.7 Plus
Dgri\GH19766-PA 130 GH19766-PA 15..130 17..129 193 40.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG13510-PC 129 CG13510-PC 1..129 1..129 745 100 Plus
CG13510-PB 129 CG13510-PB 1..129 1..129 745 100 Plus
CG13510-PA 129 CG13510-PA 1..129 1..129 745 100 Plus
CG30273-PB 128 CG30273-PB 16..127 4..129 263 41.3 Plus
CG30269-PB 144 CG30269-PB 33..142 7..128 254 41.8 Plus
CG30269-PA 144 CG30269-PA 33..142 7..128 254 41.8 Plus
CG13511-PB 122 CG13511-PB 50..120 57..127 226 47.9 Plus
CG13511-PA 122 CG13511-PA 50..120 57..127 226 47.9 Plus
CG42565-PB 135 CG42565-PB 10..135 6..127 225 36.7 Plus
CG42565-PA 135 CG42565-PA 10..135 6..127 225 36.7 Plus
CG4250-PB 134 CG4250-PB 8..134 19..129 219 38.6 Plus
CG32280-PD 130 CG32280-PD 15..128 6..127 217 36.6 Plus
CG32280-PC 130 CG32280-PC 15..128 6..127 217 36.6 Plus
CG32280-PB 130 CG32280-PB 15..128 6..127 217 36.6 Plus
CG32280-PA 130 CG32280-PA 15..128 6..127 217 36.6 Plus
CG42566-PA 77 CG42566-PA 5..76 57..128 212 47.2 Plus
CG42566-PB 77 CG42566-PB 5..76 57..128 212 47.2 Plus
CG4250-PA 121 CG4250-PA 8..121 19..129 210 39 Plus
CG13516-PB 168 CG13516-PB 41..161 6..127 197 34.1 Plus
CG13516-PA 168 CG13516-PA 41..161 6..127 197 34.1 Plus
CG12645-PC 202 CG12645-PC 118..189 57..127 162 40.3 Plus
CG12645-PB 206 CG12645-PB 122..193 57..127 162 40.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 15:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20298-PA 135 GI20298-PA 1..135 1..129 500 91.1 Plus
Dmoj\GI20299-PA 103 GI20299-PA 4..103 14..129 398 69 Plus
Dmoj\GI20300-PA 165 GI20300-PA 48..162 12..126 390 63.2 Plus
Dmoj\GI20305-PA 122 GI20305-PA 9..122 23..129 200 42.7 Plus
Dmoj\GI20306-PA 76 GI20306-PA 4..76 56..128 192 47.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 15:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11361-PA 129 GL11361-PA 1..129 1..129 654 96.9 Plus
Dper\GL11366-PA 129 GL11366-PA 45..128 43..129 208 46 Plus
Dper\GL11367-PA 143 GL11367-PA 71..142 58..129 200 52.8 Plus
Dper\GL11362-PA 121 GL11362-PA 39..120 47..128 196 45.1 Plus
Dper\GL11364-PA 77 GL11364-PA 4..77 56..129 177 45.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 15:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12335-PA 129 GA12335-PA 1..129 1..129 654 96.9 Plus
Dpse\GA15742-PA 129 GA15742-PA 45..128 43..129 208 46 Plus
Dpse\GA15738-PA 143 GA15738-PA 71..142 58..129 200 52.8 Plus
Dpse\GA12336-PA 121 GA12336-PA 39..120 47..128 197 45.1 Plus
Dpse\GA24696-PA 77 GA24696-PA 4..77 56..129 177 45.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 15:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15931-PA 129 GM15931-PA 1..129 1..129 661 99.2 Plus
Dsec\GM15936-PA 156 GM15936-PA 73..155 44..129 231 51.2 Plus
Dsec\GM15937-PA 144 GM15937-PA 33..143 7..129 210 41.5 Plus
Dsec\GM15934-PA 147 GM15934-PA 75..147 57..129 192 47.9 Plus
Dsec\GM14539-PA 130 GM14539-PA 56..130 56..129 164 42.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 15:55:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11684-PA 129 GD11684-PA 1..129 1..129 661 99.2 Plus
Dsim\GD11689-PA 128 GD11689-PA 44..127 43..129 229 50.6 Plus
Dsim\GD11691-PA 144 GD11691-PA 33..143 7..129 210 41.5 Plus
Dsim\GD11685-PA 122 GD11685-PA 48..121 55..128 200 47.3 Plus
Dsim\GD11687-PA 77 GD11687-PA 5..77 57..129 182 46.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 15:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22026-PA 137 GJ22026-PA 1..137 1..129 500 85.4 Plus
Dvir\GJ22027-PA 152 GJ22027-PA 1..149 1..126 318 53.7 Plus
Dvir\GJ22029-PA 77 GJ22029-PA 4..77 56..129 205 50 Plus
Dvir\GJ22030-PA 99 GJ22030-PA 27..99 57..129 202 53.4 Plus
Dvir\GJ22033-PA 113 GJ22033-PA 40..112 57..129 201 49.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 15:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21440-PA 130 GK21440-PA 1..130 1..129 579 90 Plus
Dwil\GK21444-PA 121 GK21444-PA 13..120 1..129 224 39.5 Plus
Dwil\GK19389-PA 126 GK19389-PA 15..123 2..128 207 37 Plus
Dwil\GK21443-PA 150 GK21443-PA 78..150 57..129 202 50.7 Plus
Dwil\GK21445-PA 148 GK21445-PA 76..145 58..127 195 52.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 15:55:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14003-PA 128 GE14003-PA 2..128 3..129 648 99.2 Plus
Dyak\GE14008-PA 128 GE14008-PA 44..127 43..129 228 50.6 Plus
Dyak\GE14009-PA 148 GE14009-PA 33..147 7..129 216 40.7 Plus
Dyak\GE14006-PA 77 GE14006-PA 4..77 56..129 190 47.3 Plus
Dyak\GE20364-PA 130 GE20364-PA 18..130 4..129 184 37 Plus