Clone MIP04352 Report

Search the DGRC for MIP04352

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:43
Well:52
Vector:pOT2
Associated Gene/TranscriptCG12418-RA
Protein status:MIP04352.pep: Imported from assembly
Sequenced Size:822

Clone Sequence Records

MIP04352.complete Sequence

822 bp assembled on 2009-04-10

GenBank Submission: BT082034.1

> MIP04352.complete
CGGAAGCAGACCGATAAGCGCTTTTCGGGCAATTCCGCCAAACCAAAACA
ACTGAAAAATACCCAACAGCCAAGTGAAAAGCCAAGCAAACTAAGTTGTA
GCCAAAAACCCAAGACAAACGGGCCCTCTTCTGGTGTTCCGTTTAGTTTT
TTTGGGCAATTTTGAAGCAAAATAGCCGCATTCACAAAGCGAAACGCAAA
AAACCTAAAAGTCAAAACAAATCAGTGCAGCAGCCGCCAATTGCATCGCA
TATTGCTCTCTGTGTTGTGTCAGTGTGTTGTGTGTATAAGTGTGCGTGTG
TGTGTGAGTGCTGGTAAGAAAACTGAGAGAAAAGTGAAAAGTAACGACCG
GCAAAAGCGCGAAAAACGAAAAACAAAAAAAACTTTCCCCGCAGGAAACT
CGAACTGCAAGCTGACGTTACAAGCGGTCAAAATTGGATTATGCTTAGGC
ACAAACGCAACTGCCACGCCATTCAGACGCCCAGCGACGCCGAGCATGTG
AAGTTAAAGCCGCATTTTCATCCGCCCCAGTGGCTCCTGCACCGCGTCAC
CTTCTCTTTGGAGCTGTATCACAAGAATATCATCAAGAAACTGCCCAGTC
TTGGCCAATTTCACGTTTACCGGCTGACCAAGAACGTCTGCCAGACTTAA
GTAATACCCATAACAAATATCCCCATATAGTCCGCAATAAACTCCACAAA
AAAGACAAAGTGCGTTTAATAACCATTACAAAAAAAGTGTAACTGATTGG
GAAGAAGTGTGCAACAAATATCCACAAAATAAATTACTCTAATGCAACTA
AAAAAAAAAAAAAAAAAAAAAA

MIP04352.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:30:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG34360-RD 4797 CG34360-RD 21..825 1..805 3935 99.2 Plus
CG34360-RA 4353 CG34360-RA 27..831 1..805 3935 99.2 Plus
CG34360.a 6672 CG34360.a 23..827 1..805 3935 99.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5700530..5701326 1..797 3925 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9874701..9875505 1..805 3935 99.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9615532..9616336 1..805 3935 99.2 Plus
Blast to na_te.dros performed 2019-03-16 18:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
Ivk 5402 Ivk IVK 5402bp 2619..2674 651..704 113 69.6 Plus

MIP04352.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:33:44 Download gff for MIP04352.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5700530..5701327 1..799 93   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:21 Download gff for MIP04352.complete
Subject Subject Range Query Range Percent Splice Strand
CG12418-RA 1..210 441..650 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-10 11:30:00 Download gff for MIP04352.complete
Subject Subject Range Query Range Percent Splice Strand
CG34360-RD 21..818 1..799 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:44:53 Download gff for MIP04352.complete
Subject Subject Range Query Range Percent Splice Strand
CG34360-RD 21..818 1..799 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:40 Download gff for MIP04352.complete
Subject Subject Range Query Range Percent Splice Strand
Glut4EF-RC 21..818 1..799 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:42:46 Download gff for MIP04352.complete
Subject Subject Range Query Range Percent Splice Strand
Glut4EF-RC 21..818 1..799 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:44 Download gff for MIP04352.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9874701..9875498 1..799 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:44 Download gff for MIP04352.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9874701..9875498 1..799 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:33:44 Download gff for MIP04352.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9874701..9875498 1..799 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:40 Download gff for MIP04352.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5700423..5701220 1..799 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:40 Download gff for MIP04352.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5700423..5701220 1..799 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:20:03 Download gff for MIP04352.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9615532..9616329 1..799 99   Plus

MIP04352.pep Sequence

Translation from 440 to 649

> MIP04352.pep
MLRHKRNCHAIQTPSDAEHVKLKPHFHPPQWLLHRVTFSLELYHKNIIKK
LPSLGQFHVYRLTKNVCQT*

MIP04352.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:24:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17846-PA 93 GF17846-PA 1..93 1..69 251 59.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:24:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17236-PA 69 GG17236-PA 1..69 1..69 354 97.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:24:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10675-PA 87 GI10675-PA 1..87 1..69 139 48.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11620-PA 94 GA11620-PA 1..94 1..69 220 55.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23847-PA 79 GM23847-PA 1..57 1..57 301 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:24:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15149-PA 69 GD15149-PA 1..69 1..69 363 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:24:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23027-PA 85 GJ23027-PA 1..85 1..69 175 54.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18930-PA 68 GK18930-PA 1..68 1..69 146 47.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25996-PA 69 GE25996-PA 1..69 1..69 359 98.6 Plus

MIP04352.hyp Sequence

Translation from 440 to 649

> MIP04352.hyp
MLRHKRNCHAIQTPSDAEHVKLKPHFHPPQWLLHRVTFSLELYHKNIIKK
LPSLGQFHVYRLTKNVCQT*
Sequence MIP04352.hyp has no blast hits.