Clone MIP04383 Report

Search the DGRC for MIP04383

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:43
Well:83
Vector:pOT2
Associated Gene/TranscriptCG13564-RA
Protein status:MIP04383.pep: gold
Sequenced Size:464

Clone Sequence Records

MIP04383.complete Sequence

464 bp assembled on 2009-02-09

GenBank Submission: BT058077.1

> MIP04383.complete
CTTAACTTATACTCCTCGAAATTTTGGAAATTGCTTGAAGATCGAAAATG
TCCCATGAACCGCAGAAGCCCGCCAAGTCAGCAGTGAAGGAGCCTCCGGT
TGTGAGCGAGGAGACCAGAACCACGGACAAGTGCCTGGCGGACTTTTGCT
TGAAGGGTGGAAGTGGCCTGATCATCGGCAGCGCGGTCACCTTGTTCTTC
ACGCGCCCACAAACCTATCCCATTTGGCTGGGACTGGGCGTCGGTATGGG
CGTGGCCTACGACTGCTGCCAGGCCCGCTGGAATCAACAGTAGTGTTCGA
AAGATCTCTGAGCTTCGATTAAATGTGGGCTTCCTCTCGATAAACGTTCT
AGATACAACAGGGCTTCCGCTTTTGTAATCATTTTAAATATTCTCGGAAA
TTCCCCCCCTCCTAATTGCTTGTATTGTATTAAAGTGCAGAAAAAACCCA
AAAAAAAAAAAAAA

MIP04383.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13564-RA 491 CG13564-RA 51..491 1..440 2165 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19966953..19967402 1..449 2125 98.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24080975..24081427 1..452 2215 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24082174..24082626 1..452 2225 99.7 Plus
Blast to na_te.dros performed on 2019-03-16 10:36:28 has no hits.

MIP04383.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:37:39 Download gff for MIP04383.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19966953..19967402 1..449 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:21 Download gff for MIP04383.complete
Subject Subject Range Query Range Percent Splice Strand
CG13564-RA 1..246 48..293 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:34:17 Download gff for MIP04383.complete
Subject Subject Range Query Range Percent Splice Strand
CG13564-RA 1..246 48..293 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:43:13 Download gff for MIP04383.complete
Subject Subject Range Query Range Percent Splice Strand
CG13564-RA 1..246 48..293 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:12:41 Download gff for MIP04383.complete
Subject Subject Range Query Range Percent Splice Strand
CG13564-RA 1..246 48..293 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-09 09:56:52 Download gff for MIP04383.complete
Subject Subject Range Query Range Percent Splice Strand
CG13564-RA 51..468 1..417 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:34:16 Download gff for MIP04383.complete
Subject Subject Range Query Range Percent Splice Strand
CG13564-RA 51..468 1..417 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:43:13 Download gff for MIP04383.complete
Subject Subject Range Query Range Percent Splice Strand
CG13564-RA 51..500 1..449 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:12:41 Download gff for MIP04383.complete
Subject Subject Range Query Range Percent Splice Strand
CG13564-RA 51..500 1..449 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:37:39 Download gff for MIP04383.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24080975..24081424 1..449 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:37:39 Download gff for MIP04383.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24080975..24081424 1..449 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:37:39 Download gff for MIP04383.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24080975..24081424 1..449 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:43:13 Download gff for MIP04383.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19968498..19968947 1..449 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:07:37 Download gff for MIP04383.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24082192..24082641 1..449 99   Plus

MIP04383.hyp Sequence

Translation from 47 to 292

> MIP04383.hyp
MSHEPQKPAKSAVKEPPVVSEETRTTDKCLADFCLKGGSGLIIGSAVTLF
FTRPQTYPIWLGLGVGMGVAYDCCQARWNQQ*

MIP04383.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13564-PA 81 CG13564-PA 1..81 1..81 441 100 Plus
CG12479-PA 74 CG12479-PA 14..66 27..79 150 50.9 Plus
CG41128-PB 72 CG41128-PB 17..69 27..79 141 45.3 Plus

MIP04383.pep Sequence

Translation from 47 to 292

> MIP04383.pep
MSHEPQKPAKSAVKEPPVVSEETRTTDKCLADFCLKGGSGLIIGSAVTLF
FTRPQTYPIWLGLGVGMGVAYDCCQARWNQQ*

MIP04383.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19235-PA 74 GF19235-PA 12..67 25..80 149 48.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22938-PA 81 GG22938-PA 1..81 1..81 390 85.2 Plus
Dere\GG19471-PA 74 GG19471-PA 14..67 27..80 150 50 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG13564-PA 81 CG13564-PA 1..81 1..81 441 100 Plus
CG12479-PA 74 CG12479-PA 14..66 27..79 150 50.9 Plus
CG41128-PB 72 CG41128-PB 17..69 27..79 141 45.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11664-PA 86 GL11664-PA 1..77 1..77 252 55.8 Plus
Dper\GL21878-PA 96 GL21878-PA 40..94 25..80 129 48.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12365-PA 86 GA12365-PA 1..77 1..77 252 55.8 Plus
Dpse\GA28225-PA 69 GA28225-PA 14..63 27..76 130 42 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:59:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18303-PA 81 GM18303-PA 1..81 1..81 422 97.5 Plus
Dsec\GM17571-PA 74 GM17571-PA 12..67 25..80 151 48.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:59:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15460-PA 81 GD15460-PA 1..81 1..81 422 97.5 Plus
Dsim\GD15861-PA 74 GD15861-PA 12..67 25..80 151 48.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:59:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19385-PA 72 GK19385-PA 7..64 21..78 241 70.7 Plus
Dwil\GK18838-PA 75 GK18838-PA 2..72 11..79 133 36.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:59:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14376-PA 81 GE14376-PA 1..81 1..81 383 85.2 Plus
Dyak\GE16125-PA 74 GE16125-PA 14..67 27..80 150 50 Plus