MIP04383.complete Sequence
464 bp assembled on 2009-02-09
GenBank Submission: BT058077.1
> MIP04383.complete
CTTAACTTATACTCCTCGAAATTTTGGAAATTGCTTGAAGATCGAAAATG
TCCCATGAACCGCAGAAGCCCGCCAAGTCAGCAGTGAAGGAGCCTCCGGT
TGTGAGCGAGGAGACCAGAACCACGGACAAGTGCCTGGCGGACTTTTGCT
TGAAGGGTGGAAGTGGCCTGATCATCGGCAGCGCGGTCACCTTGTTCTTC
ACGCGCCCACAAACCTATCCCATTTGGCTGGGACTGGGCGTCGGTATGGG
CGTGGCCTACGACTGCTGCCAGGCCCGCTGGAATCAACAGTAGTGTTCGA
AAGATCTCTGAGCTTCGATTAAATGTGGGCTTCCTCTCGATAAACGTTCT
AGATACAACAGGGCTTCCGCTTTTGTAATCATTTTAAATATTCTCGGAAA
TTCCCCCCCTCCTAATTGCTTGTATTGTATTAAAGTGCAGAAAAAACCCA
AAAAAAAAAAAAAA
MIP04383.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:22:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13564-RA | 491 | CG13564-RA | 51..491 | 1..440 | 2165 | 99.7 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:36:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 19966953..19967402 | 1..449 | 2125 | 98.7 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:36:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 24080975..24081427 | 1..452 | 2215 | 99.8 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 24082174..24082626 | 1..452 | 2225 | 99.7 | Plus |
Blast to na_te.dros performed on 2019-03-16 10:36:28 has no hits.
MIP04383.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:37:39 Download gff for
MIP04383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 19966953..19967402 | 1..449 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:21 Download gff for
MIP04383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13564-RA | 1..246 | 48..293 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:34:17 Download gff for
MIP04383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13564-RA | 1..246 | 48..293 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:43:13 Download gff for
MIP04383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13564-RA | 1..246 | 48..293 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:12:41 Download gff for
MIP04383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13564-RA | 1..246 | 48..293 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-09 09:56:52 Download gff for
MIP04383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13564-RA | 51..468 | 1..417 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:34:16 Download gff for
MIP04383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13564-RA | 51..468 | 1..417 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:43:13 Download gff for
MIP04383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13564-RA | 51..500 | 1..449 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:12:41 Download gff for
MIP04383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13564-RA | 51..500 | 1..449 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:37:39 Download gff for
MIP04383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24080975..24081424 | 1..449 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:37:39 Download gff for
MIP04383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24080975..24081424 | 1..449 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:37:39 Download gff for
MIP04383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24080975..24081424 | 1..449 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:43:13 Download gff for
MIP04383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 19968498..19968947 | 1..449 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:07:37 Download gff for
MIP04383.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24082192..24082641 | 1..449 | 99 | | Plus |
MIP04383.hyp Sequence
Translation from 47 to 292
> MIP04383.hyp
MSHEPQKPAKSAVKEPPVVSEETRTTDKCLADFCLKGGSGLIIGSAVTLF
FTRPQTYPIWLGLGVGMGVAYDCCQARWNQQ*
MIP04383.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13564-PA | 81 | CG13564-PA | 1..81 | 1..81 | 441 | 100 | Plus |
CG12479-PA | 74 | CG12479-PA | 14..66 | 27..79 | 150 | 50.9 | Plus |
CG41128-PB | 72 | CG41128-PB | 17..69 | 27..79 | 141 | 45.3 | Plus |
MIP04383.pep Sequence
Translation from 47 to 292
> MIP04383.pep
MSHEPQKPAKSAVKEPPVVSEETRTTDKCLADFCLKGGSGLIIGSAVTLF
FTRPQTYPIWLGLGVGMGVAYDCCQARWNQQ*
MIP04383.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:59:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF19235-PA | 74 | GF19235-PA | 12..67 | 25..80 | 149 | 48.2 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:59:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22938-PA | 81 | GG22938-PA | 1..81 | 1..81 | 390 | 85.2 | Plus |
Dere\GG19471-PA | 74 | GG19471-PA | 14..67 | 27..80 | 150 | 50 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13564-PA | 81 | CG13564-PA | 1..81 | 1..81 | 441 | 100 | Plus |
CG12479-PA | 74 | CG12479-PA | 14..66 | 27..79 | 150 | 50.9 | Plus |
CG41128-PB | 72 | CG41128-PB | 17..69 | 27..79 | 141 | 45.3 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:59:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL11664-PA | 86 | GL11664-PA | 1..77 | 1..77 | 252 | 55.8 | Plus |
Dper\GL21878-PA | 96 | GL21878-PA | 40..94 | 25..80 | 129 | 48.2 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:59:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA12365-PA | 86 | GA12365-PA | 1..77 | 1..77 | 252 | 55.8 | Plus |
Dpse\GA28225-PA | 69 | GA28225-PA | 14..63 | 27..76 | 130 | 42 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:59:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18303-PA | 81 | GM18303-PA | 1..81 | 1..81 | 422 | 97.5 | Plus |
Dsec\GM17571-PA | 74 | GM17571-PA | 12..67 | 25..80 | 151 | 48.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:59:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD15460-PA | 81 | GD15460-PA | 1..81 | 1..81 | 422 | 97.5 | Plus |
Dsim\GD15861-PA | 74 | GD15861-PA | 12..67 | 25..80 | 151 | 48.2 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:59:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK19385-PA | 72 | GK19385-PA | 7..64 | 21..78 | 241 | 70.7 | Plus |
Dwil\GK18838-PA | 75 | GK18838-PA | 2..72 | 11..79 | 133 | 36.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:59:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE14376-PA | 81 | GE14376-PA | 1..81 | 1..81 | 383 | 85.2 | Plus |
Dyak\GE16125-PA | 74 | GE16125-PA | 14..67 | 27..80 | 150 | 50 | Plus |