MIP04475.complete Sequence
507 bp assembled on 2009-04-07
GenBank Submission: BT081995.1
> MIP04475.complete
TGGAGAAGGAATACGACATCGAAATGGATCACAAGTGGATAATATTTTTC
TTCAGCATTGCTGCTCTGCTCTTATGCAATTTTGTTAGAGCCGATGAAAC
GGAAACGGAAGTGGTGCAGGAGAAACCAAGCTCTATTCAGCTGCTGGACG
CCGGAGAAACGGCCCAGTCTGATTCCACAGACGAGAACGTTAGGAAAGTG
CGCCAGTACTTTGGACCACCACCGTTTGGACCACCGCCACCACCCTTCTT
TGGACCACCTCCACCACCGTACTACGGCGGCGGCTTTGGTGGCGGATTCG
GCGGTGGTTTCCAGAGAACTCGAGTGGTCACCCGCACCCGTTACCGCGGA
CGCGGTGGTTACTATGGCGGTGGATTCTACGGCTAATCAGTTTGCATGGA
TTTGATTGTGCTTGATTGTGATTTGTGATACTTCTTTTGTGCTGCCCCAT
TGGGTGCAATAAAATTGCTTGCCTTATGCAAGTTCATCCAAAAAAAAAAA
AAAAAAA
MIP04475.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:29:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13227-RA | 502 | CG13227-RA | 14..502 | 1..489 | 2445 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:50:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 7122733..7123221 | 1..489 | 2445 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:50:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 11235267..11235757 | 1..491 | 2455 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 11236466..11236956 | 1..491 | 2455 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 18:50:27 has no hits.
MIP04475.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:51:17 Download gff for
MIP04475.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 7122733..7123221 | 1..489 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:08:57 Download gff for
MIP04475.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13227-RA | 1..363 | 24..386 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:44:20 Download gff for
MIP04475.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13227-RA | 1..363 | 24..386 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:33:55 Download gff for
MIP04475.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13227-RA | 1..363 | 24..386 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:03:03 Download gff for
MIP04475.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13227-RA | 1..363 | 24..386 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-07 16:31:15 Download gff for
MIP04475.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13227-RA | 14..399 | 1..386 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:44:20 Download gff for
MIP04475.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13227-RA | 14..502 | 1..489 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:33:55 Download gff for
MIP04475.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13227-RA | 16..504 | 1..489 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:03:03 Download gff for
MIP04475.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13227-RA | 16..504 | 1..489 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:51:17 Download gff for
MIP04475.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11235267..11235755 | 1..489 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:51:17 Download gff for
MIP04475.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11235267..11235755 | 1..489 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:51:17 Download gff for
MIP04475.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11235267..11235755 | 1..489 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:33:55 Download gff for
MIP04475.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 7122772..7123260 | 1..489 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:19:26 Download gff for
MIP04475.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11236466..11236954 | 1..489 | 100 | | Plus |
MIP04475.hyp Sequence
Translation from 2 to 385
> MIP04475.hyp
EKEYDIEMDHKWIIFFFSIAALLLCNFVRADETETEVVQEKPSSIQLLDA
GETAQSDSTDENVRKVRQYFGPPPFGPPPPPFFGPPPPPYYGGGFGGGFG
GGFQRTRVVTRTRYRGRGGYYGGGFYG*
MIP04475.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:54:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13227-PA | 120 | CG13227-PA | 1..120 | 8..127 | 668 | 100 | Plus |
MIP04475.pep Sequence
Translation from 2 to 385
> MIP04475.pep
EKEYDIEMDHKWIIFFFSIAALLLCNFVRADETETEVVQEKPSSIQLLDA
GETAQSDSTDENVRKVRQYFGPPPFGPPPPPFFGPPPPPYYGGGFGGGFG
GGFQRTRVVTRTRYRGRGGYYGGGFYG*
MIP04475.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:19:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF12530-PA | 120 | GF12530-PA | 1..69 | 8..76 | 162 | 62.5 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:19:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG20172-PA | 125 | GG20172-PA | 1..107 | 8..109 | 232 | 75.7 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13227-PA | 120 | CG13227-PA | 1..120 | 8..127 | 668 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:19:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM21261-PA | 120 | GM21261-PA | 1..102 | 8..109 | 262 | 92.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:19:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD10775-PA | 120 | GD10775-PA | 1..102 | 8..109 | 258 | 95.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:19:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12862-PA | 120 | GE12862-PA | 1..102 | 8..109 | 266 | 89.2 | Plus |