Clone MIP04475 Report

Search the DGRC for MIP04475

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:44
Well:75
Vector:pOT2
Associated Gene/TranscriptCG13227-RA
Protein status:MIP04475.pep: gold
Sequenced Size:507

Clone Sequence Records

MIP04475.complete Sequence

507 bp assembled on 2009-04-07

GenBank Submission: BT081995.1

> MIP04475.complete
TGGAGAAGGAATACGACATCGAAATGGATCACAAGTGGATAATATTTTTC
TTCAGCATTGCTGCTCTGCTCTTATGCAATTTTGTTAGAGCCGATGAAAC
GGAAACGGAAGTGGTGCAGGAGAAACCAAGCTCTATTCAGCTGCTGGACG
CCGGAGAAACGGCCCAGTCTGATTCCACAGACGAGAACGTTAGGAAAGTG
CGCCAGTACTTTGGACCACCACCGTTTGGACCACCGCCACCACCCTTCTT
TGGACCACCTCCACCACCGTACTACGGCGGCGGCTTTGGTGGCGGATTCG
GCGGTGGTTTCCAGAGAACTCGAGTGGTCACCCGCACCCGTTACCGCGGA
CGCGGTGGTTACTATGGCGGTGGATTCTACGGCTAATCAGTTTGCATGGA
TTTGATTGTGCTTGATTGTGATTTGTGATACTTCTTTTGTGCTGCCCCAT
TGGGTGCAATAAAATTGCTTGCCTTATGCAAGTTCATCCAAAAAAAAAAA
AAAAAAA

MIP04475.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG13227-RA 502 CG13227-RA 14..502 1..489 2445 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7122733..7123221 1..489 2445 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11235267..11235757 1..491 2455 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11236466..11236956 1..491 2455 100 Plus
Blast to na_te.dros performed on 2019-03-15 18:50:27 has no hits.

MIP04475.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:51:17 Download gff for MIP04475.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7122733..7123221 1..489 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:08:57 Download gff for MIP04475.complete
Subject Subject Range Query Range Percent Splice Strand
CG13227-RA 1..363 24..386 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:44:20 Download gff for MIP04475.complete
Subject Subject Range Query Range Percent Splice Strand
CG13227-RA 1..363 24..386 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:33:55 Download gff for MIP04475.complete
Subject Subject Range Query Range Percent Splice Strand
CG13227-RA 1..363 24..386 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:03:03 Download gff for MIP04475.complete
Subject Subject Range Query Range Percent Splice Strand
CG13227-RA 1..363 24..386 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-07 16:31:15 Download gff for MIP04475.complete
Subject Subject Range Query Range Percent Splice Strand
CG13227-RA 14..399 1..386 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:44:20 Download gff for MIP04475.complete
Subject Subject Range Query Range Percent Splice Strand
CG13227-RA 14..502 1..489 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:33:55 Download gff for MIP04475.complete
Subject Subject Range Query Range Percent Splice Strand
CG13227-RA 16..504 1..489 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:03:03 Download gff for MIP04475.complete
Subject Subject Range Query Range Percent Splice Strand
CG13227-RA 16..504 1..489 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:51:17 Download gff for MIP04475.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11235267..11235755 1..489 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:51:17 Download gff for MIP04475.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11235267..11235755 1..489 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:51:17 Download gff for MIP04475.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11235267..11235755 1..489 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:33:55 Download gff for MIP04475.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7122772..7123260 1..489 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:19:26 Download gff for MIP04475.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11236466..11236954 1..489 100   Plus

MIP04475.hyp Sequence

Translation from 2 to 385

> MIP04475.hyp
EKEYDIEMDHKWIIFFFSIAALLLCNFVRADETETEVVQEKPSSIQLLDA
GETAQSDSTDENVRKVRQYFGPPPFGPPPPPFFGPPPPPYYGGGFGGGFG
GGFQRTRVVTRTRYRGRGGYYGGGFYG*

MIP04475.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:54:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG13227-PA 120 CG13227-PA 1..120 8..127 668 100 Plus

MIP04475.pep Sequence

Translation from 2 to 385

> MIP04475.pep
EKEYDIEMDHKWIIFFFSIAALLLCNFVRADETETEVVQEKPSSIQLLDA
GETAQSDSTDENVRKVRQYFGPPPFGPPPPPFFGPPPPPYYGGGFGGGFG
GGFQRTRVVTRTRYRGRGGYYGGGFYG*

MIP04475.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:19:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12530-PA 120 GF12530-PA 1..69 8..76 162 62.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:19:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20172-PA 125 GG20172-PA 1..107 8..109 232 75.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG13227-PA 120 CG13227-PA 1..120 8..127 668 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:19:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21261-PA 120 GM21261-PA 1..102 8..109 262 92.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:19:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10775-PA 120 GD10775-PA 1..102 8..109 258 95.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:19:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12862-PA 120 GE12862-PA 1..102 8..109 266 89.2 Plus