Clone MIP04547 Report

Search the DGRC for MIP04547

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:45
Well:47
Vector:pOT2
Associated Gene/TranscriptCG12224-RB
Protein status:MIP04547.pep: gold
Sequenced Size:885

Clone Sequence Records

MIP04547.complete Sequence

885 bp assembled on 2009-02-10

GenBank Submission: BT058096.1

> MIP04547.complete
AAAGGATGTACCCCGGGAGGCCTATTATATTGCCACTAAAGTGGCGCGCT
ACGGGCTGGATCCGAAGAATATGTTTGACTATTCGGCTGACAAAGCTCGG
GAGAGTGTGAAGCGGAGTCTGGAGCGGCTCCAGTTGGACAGGGTGGACAT
ACTACAGGTTCATGACGTGGACGCGGCACCCAATCTAGACATAGTGCTGA
ATGAGACCATACCCGTCCTCGAGGAGTACGTCCAGGCGGGAAAGGCTCGA
TTCATCGGAGTCACCGCCTACGATGTGGACGTGCTGAAGGAGTGTGCCGA
GCGGGGCAAGGGTCGCATTCAGGTGGTGCTCAACTATGCTCGTTACACCC
TTTTAGACAACACCTTGCTGCGCTACATGAAGGACTTCCAGAAAATGGGA
GTGGGCGTTGTCTGTGCGGCCGCTCACTCATTGGGACTCTTGAGAAACGC
TGGACCACATGCATCGCATCCCGGTAGTCAGGAAATCCTGGCCGTGGCCA
AACGGGGGGCCGAAATCTGCCAGCAGAGGAACGTGGAGCTGGGAAAGCTG
GCCATGTACTATACGATGCAACTGGATGGGGCGGCCACCTTCCTCATCGG
CATCCCCAACCGAAAGCTGCTGCGGATTAACCTGGACGCGATCTTCGACG
GTCTCACTTCCCACGAACAGGAAGTGCTGCAGTATTTGCGCGAAAACGTC
TTTACCAAGTCCTACAGTTGGGGATCCACTTTATCCACGGCTAAGTTGTT
AAAGTGAGAAACCAATAAATCAATGGAAATGCAGAAAGAACGGATTTAAA
ATAAACTTTAGATTATACAATTCACTTAAATAAAAAGTTATTAAGGGAAA
AAAAAAAATAAAATAAAAAAAAAAAAAAAAAAAAA

MIP04547.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:23:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG12224.c 1491 CG12224.c 634..1482 1..849 4245 100 Plus
CG12224.b 1579 CG12224.b 722..1570 1..849 4245 100 Plus
CG12224.a 1179 CG12224.a 322..1170 1..849 4245 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7806417..7806959 696..154 2715 100 Minus
chr3R 27901430 chr3R 7808898..7809440 696..154 2070 92.1 Minus
chr3R 27901430 chr3R 7807009..7807167 159..1 795 100 Minus
chr3R 27901430 chr3R 7806107..7806259 849..697 765 100 Minus
chr3R 27901430 chr3R 7809490..7809647 159..2 520 88.6 Minus
chr3R 27901430 chr3R 7808522..7808596 835..761 240 88 Minus
chr3R 27901430 chr3R 7808634..7808695 758..697 205 88.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11981012..11981554 696..154 2715 100 Minus
3R 32079331 3R 11983486..11984028 696..154 2070 92.1 Minus
3R 32079331 3R 11981604..11981762 159..1 795 100 Minus
3R 32079331 3R 11980702..11980854 849..697 765 100 Minus
3R 32079331 3R 11984078..11984235 159..2 535 89.2 Minus
3R 32079331 3R 11983110..11983184 835..761 240 88 Minus
3R 32079331 3R 11983222..11983283 758..697 205 88.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:40:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11721843..11722385 696..154 2715 100 Minus
3R 31820162 3R 11724317..11724859 696..154 2070 92 Minus
3R 31820162 3R 11722435..11722593 159..1 795 100 Minus
3R 31820162 3R 11721533..11721685 849..697 765 100 Minus
3R 31820162 3R 11724909..11725066 159..2 535 89.2 Minus
3R 31820162 3R 11723941..11724015 835..761 240 88 Minus
3R 31820162 3R 11724053..11724114 758..697 205 88.7 Minus
3R 31820162 3R 11720107..11720143 568..532 155 94.5 Minus
Blast to na_te.dros performed 2019-03-16 06:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker4 7359 Stalker4 STALKER4 7359bp 587..660 749..819 128 67.6 Plus

MIP04547.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:56:58 Download gff for MIP04547.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7806104..7806259 697..852 98 <- Minus
chr3R 7806417..7806955 158..696 100 <- Minus
chr3R 7807011..7807167 1..157 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:29 Download gff for MIP04547.complete
Subject Subject Range Query Range Percent Splice Strand
CG12224-RA 186..885 1..701 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:34:28 Download gff for MIP04547.complete
Subject Subject Range Query Range Percent Splice Strand
CG12224-RA 186..885 1..701 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:20:52 Download gff for MIP04547.complete
Subject Subject Range Query Range Percent Splice Strand
CG12224-RB 1..687 71..757 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:25:57 Download gff for MIP04547.complete
Subject Subject Range Query Range Percent Splice Strand
CG12224-RB 1..687 71..757 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-10 14:46:24 Download gff for MIP04547.complete
Subject Subject Range Query Range Percent Splice Strand
CG12224-RA 186..881 1..696 100 -> Plus
CG12224-RA 1039..1061 697..719 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:34:28 Download gff for MIP04547.complete
Subject Subject Range Query Range Percent Splice Strand
CG12224-RA 186..881 1..696 100 -> Plus
CG12224-RA 1039..1061 697..719 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:20:52 Download gff for MIP04547.complete
Subject Subject Range Query Range Percent Splice Strand
CG12224-RB 263..1109 1..847 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:25:57 Download gff for MIP04547.complete
Subject Subject Range Query Range Percent Splice Strand
CG12224-RB 263..1109 1..847 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:56:58 Download gff for MIP04547.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11980700..11980854 697..851 99 <- Minus
3R 11981012..11981550 158..696 100 <- Minus
3R 11981606..11981762 1..157 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:56:58 Download gff for MIP04547.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11980700..11980854 697..851 99 <- Minus
3R 11981012..11981550 158..696 100 <- Minus
3R 11981606..11981762 1..157 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:56:58 Download gff for MIP04547.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11980700..11980854 697..851 99 <- Minus
3R 11981012..11981550 158..696 100 <- Minus
3R 11981606..11981762 1..157 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:20:52 Download gff for MIP04547.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7806422..7806576 697..851 99 <- Minus
arm_3R 7806734..7807272 158..696 100 <- Minus
arm_3R 7807328..7807484 1..157 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:07:49 Download gff for MIP04547.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11721843..11722381 158..696 100 <- Minus
3R 11722437..11722593 1..157 100   Minus
3R 11721531..11721685 697..851 99 <- Minus

MIP04547.hyp Sequence

Translation from 0 to 756

> MIP04547.hyp
KDVPREAYYIATKVARYGLDPKNMFDYSADKARESVKRSLERLQLDRVDI
LQVHDVDAAPNLDIVLNETIPVLEEYVQAGKARFIGVTAYDVDVLKECAE
RGKGRIQVVLNYARYTLLDNTLLRYMKDFQKMGVGVVCAAAHSLGLLRNA
GPHASHPGSQEILAVAKRGAEICQQRNVELGKLAMYYTMQLDGAATFLIG
IPNRKLLRINLDAIFDGLTSHEQEVLQYLRENVFTKSYSWGSTLSTAKLL
K*

MIP04547.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG3397-PA 342 CG3397-PA 92..342 1..251 1164 90.8 Plus
CG12224-PC 228 CG12224-PC 1..228 24..251 1154 100 Plus
CG12224-PB 228 CG12224-PB 1..228 24..251 1154 100 Plus
CG18547-PA 345 CG18547-PA 90..330 1..240 745 60.6 Plus

MIP04547.pep Sequence

Translation from 1 to 756

> MIP04547.pep
KDVPREAYYIATKVARYGLDPKNMFDYSADKARESVKRSLERLQLDRVDI
LQVHDVDAAPNLDIVLNETIPVLEEYVQAGKARFIGVTAYDVDVLKECAE
RGKGRIQVVLNYARYTLLDNTLLRYMKDFQKMGVGVVCAAAHSLGLLRNA
GPHASHPGSQEILAVAKRGAEICQQRNVELGKLAMYYTMQLDGAATFLIG
IPNRKLLRINLDAIFDGLTSHEQEVLQYLRENVFTKSYSWGSTLSTAKLL
K*

MIP04547.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:59:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17755-PA 313 GF17755-PA 63..313 1..251 1080 79.7 Plus
Dana\GF23185-PA 345 GF23185-PA 90..330 1..240 746 56.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:59:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17172-PA 313 GG17172-PA 63..313 1..251 1178 86.9 Plus
Dere\GG17173-PA 345 GG17173-PA 90..330 1..240 770 60.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12681-PA 348 GH12681-PA 90..329 1..240 705 55.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG3397-PA 342 CG3397-PA 92..342 1..251 1164 90.8 Plus
CG12224-PC 228 CG12224-PC 1..228 24..251 1154 100 Plus
CG12224-PB 228 CG12224-PB 1..228 24..251 1154 100 Plus
CG18547-PA 345 CG18547-PA 90..330 1..240 745 60.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 10:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24064-PA 342 GI24064-PA 93..342 2..251 1014 74 Plus
Dmoj\GI24065-PA 344 GI24065-PA 90..329 1..240 780 59.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21587-PA 313 GL21587-PA 63..308 1..246 1129 85 Plus
Dper\GL21588-PA 225 GL21588-PA 104..210 134..240 318 56.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17424-PB 340 GA17424-PB 90..335 1..246 1122 84.1 Plus
Dpse\GA14985-PA 344 GA14985-PA 90..329 1..240 756 58.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26052-PA 318 GM26052-PA 90..302 1..212 665 59.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20615-PA 313 GD20615-PA 63..313 1..251 1298 97.2 Plus
Dsim\GD20614-PA 342 GD20614-PA 92..342 1..251 1211 90.4 Plus
Dsim\GD20616-PA 345 GD20616-PA 90..330 1..240 771 60.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 10:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23689-PA 313 GJ23689-PA 64..313 2..251 1028 74.4 Plus
Dvir\GJ23713-PA 344 GJ23713-PA 90..329 1..240 786 59.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:59:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11669-PA 342 GK11669-PA 92..342 1..251 1089 80.1 Plus
Dwil\GK11668-PA 345 GK11668-PA 95..339 1..245 1020 75.5 Plus
Dwil\GK11670-PA 344 GK11670-PA 90..329 1..240 730 54.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24562-PA 313 GE24562-PA 63..313 1..251 1182 87.6 Plus
Dyak\GE24563-PA 345 GE24563-PA 90..330 1..240 782 60.6 Plus