Clone MIP04578 Report

Search the DGRC for MIP04578

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:45
Well:78
Vector:pOT2
Associated Gene/TranscriptCG13324-RA
Protein status:MIP04578.pep: gold
Sequenced Size:510

Clone Sequence Records

MIP04578.complete Sequence

510 bp assembled on 2009-04-10

GenBank Submission: BT082036.1

> MIP04578.complete
TTCAACTAACCTATTCAACATGCGTCTTCTGCTCATCCTCTCAGTTGTCC
TGGCCGTGATCCTCGGCTGCCACGCCTACAGCGCCACCTGGGGGCGCAGG
GTCAACAACGATTTCCTCCTCTCACGCACCAGGGAAGTTCGCAATCCGAT
CAAGAACAACTACTGGAACGTGAACGTGAACTACCCCAATGGATTCTACA
ACATCTCCGCCGTGATCGTGTACGACAACTTCAAGAACAACTCTGGAGCA
TCTCCTAGCCTCTATTCCGGCGGTCCGGGCTACCGCTTTGCCACCGTGAA
TCTTCGTGGTCAGGTGAACCGCGGAATCGACTCCACCGTCGAGATCTGGG
GTCGTTAAGTGATCTTTGGGAGCATGTTGTAAACGAATTGAAGTCGAATA
TGAAATGGCAAACATGATTAATTTTATTATACTTGAGAAGAAATTGAGAA
AGCAAAACTATGGAATCAATCAATAAAGAAAGAGTTCTAAGCAAAAAAAA
AAAAAAAAAA

MIP04578.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG13324-RA 496 CG13324-RA 1..494 1..494 2470 100 Plus
CG13323-RA 556 CG13323-RA 157..417 104..364 1035 93.1 Plus
CG13323-RA 556 CG13323-RA 66..149 13..96 390 97.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:00:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8936481..8936972 492..1 2460 100 Minus
chr2R 21145070 chr2R 8934207..8934558 364..13 1370 92.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:00:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13049144..13049637 494..1 2470 100 Minus
2R 25286936 2R 13046872..13047223 364..13 1370 92.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13050343..13050836 494..1 2470 100 Minus
2R 25260384 2R 13048071..13048331 364..104 1035 93.1 Minus
2R 25260384 2R 13048339..13048422 96..13 390 97.6 Minus
Blast to na_te.dros performed on 2019-03-15 23:00:06 has no hits.

MIP04578.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:01:01 Download gff for MIP04578.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8936481..8936972 1..492 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:18 Download gff for MIP04578.complete
Subject Subject Range Query Range Percent Splice Strand
CG13324-RA 1..339 20..358 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:45:11 Download gff for MIP04578.complete
Subject Subject Range Query Range Percent Splice Strand
CG13324-RA 1..339 20..358 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:25:39 Download gff for MIP04578.complete
Subject Subject Range Query Range Percent Splice Strand
CG13324-RA 1..339 20..358 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:17:15 Download gff for MIP04578.complete
Subject Subject Range Query Range Percent Splice Strand
CG13324-RA 1..339 20..358 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:45:10 Download gff for MIP04578.complete
Subject Subject Range Query Range Percent Splice Strand
CG13324-RA 1..473 20..492 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:25:39 Download gff for MIP04578.complete
Subject Subject Range Query Range Percent Splice Strand
CG13324-RA 1..491 1..491 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:17:15 Download gff for MIP04578.complete
Subject Subject Range Query Range Percent Splice Strand
CG13324-RA 20..511 1..492 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:01:01 Download gff for MIP04578.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13049146..13049637 1..492 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:01:01 Download gff for MIP04578.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13049146..13049637 1..492 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:01:01 Download gff for MIP04578.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13049146..13049637 1..492 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:25:39 Download gff for MIP04578.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8936651..8937142 1..492 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:20:25 Download gff for MIP04578.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13050345..13050836 1..492 100   Minus

MIP04578.hyp Sequence

Translation from 0 to 357

> MIP04578.hyp
STNLFNMRLLLILSVVLAVILGCHAYSATWGRRVNNDFLLSRTREVRNPI
KNNYWNVNVNYPNGFYNISAVIVYDNFKNNSGASPSLYSGGPGYRFATVN
LRGQVNRGIDSTVEIWGR*

MIP04578.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:24:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13324-PA 112 CG13324-PA 1..112 7..118 595 100 Plus
CG13323-PB 112 CG13323-PB 1..112 7..118 562 94.6 Plus
CG13323-PA 112 CG13323-PA 1..112 7..118 562 94.6 Plus
CG31789-PC 117 CG31789-PC 4..114 7..116 141 28.9 Plus
CG31789-PB 117 CG31789-PB 4..114 7..116 141 28.9 Plus

MIP04578.pep Sequence

Translation from 1 to 357

> MIP04578.pep
STNLFNMRLLLILSVVLAVILGCHAYSATWGRRVNNDFLLSRTREVRNPI
KNNYWNVNVNYPNGFYNISAVIVYDNFKNNSGASPSLYSGGPGYRFATVN
LRGQVNRGIDSTVEIWGR*

MIP04578.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11989-PA 115 GF11989-PA 1..115 7..118 431 72.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22531-PA 112 GG22531-PA 1..112 7..118 561 97.3 Plus
Dere\GG22532-PA 112 GG22532-PA 1..112 7..118 484 95.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17985-PA 116 GH17985-PA 9..116 15..118 351 62 Plus
Dgri\GH21596-PA 116 GH21596-PA 9..116 15..118 341 60.2 Plus
Dgri\GH21597-PA 116 GH21597-PA 1..116 7..118 340 56.9 Plus
Dgri\GH21729-PA 120 GH21729-PA 25..120 27..118 138 34.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG13324-PA 112 CG13324-PA 1..112 7..118 595 100 Plus
CG13323-PB 112 CG13323-PB 1..112 7..118 562 94.6 Plus
CG13323-PA 112 CG13323-PA 1..112 7..118 562 94.6 Plus
CG31789-PC 117 CG31789-PC 4..114 7..116 141 28.9 Plus
CG31789-PB 117 CG31789-PB 4..114 7..116 141 28.9 Plus
CG31789-PA 117 CG31789-PA 4..114 7..116 141 28.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19567-PA 118 GI19567-PA 1..116 7..118 337 56 Plus
Dmoj\GI18871-PA 119 GI18871-PA 10..119 9..118 146 34.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10591-PA 116 GL10591-PA 1..116 7..118 386 62.1 Plus
Dper\GL10590-PA 116 GL10590-PA 1..116 7..118 362 58.6 Plus
Dper\GL16235-PA 120 GL16235-PA 4..120 6..118 158 34.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:25:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12205-PA 116 GA12205-PA 1..116 7..118 386 62.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20316-PA 112 GM20316-PA 1..112 7..118 567 98.2 Plus
Dsec\GM20317-PA 112 GM20317-PA 1..112 7..118 471 92.9 Plus
Dsec\GM17281-PA 117 GM17281-PA 1..114 7..116 137 29.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25794-PA 112 GD25794-PA 1..112 7..118 566 98.2 Plus
Dsim\GD25795-PA 112 GD25795-PA 1..112 7..118 474 93.8 Plus
Dsim\GD24143-PA 117 GD24143-PA 1..114 7..116 135 29.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21142-PA 116 GJ21142-PA 1..116 7..118 360 56.9 Plus
Dvir\GJ21904-PA 118 GJ21904-PA 10..118 9..118 148 35.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21639-PA 116 GK21639-PA 1..116 7..118 400 67.2 Plus
Dwil\GK10198-PA 115 GK10198-PA 1..115 7..117 170 33 Plus
Dwil\GK21944-PA 112 GK21944-PA 1..112 7..118 153 34.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13402-PA 112 GE13402-PA 1..112 7..118 565 97.3 Plus
Dyak\GE13403-PA 112 GE13403-PA 1..112 7..118 560 97.3 Plus
Dyak\GE14474-PA 117 GE14474-PA 1..114 7..116 153 32.5 Plus
Dyak\GE13194-PA 117 GE13194-PA 1..114 7..116 153 32.5 Plus