Clone MIP04739 Report

Search the DGRC for MIP04739

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:47
Well:39
Vector:pOT2
Associated Gene/TranscriptCG15715-RA
Protein status:MIP04739.pep: gold
Sequenced Size:705

Clone Sequence Records

MIP04739.complete Sequence

705 bp assembled on 2009-04-03

GenBank Submission: BT081392.1

> MIP04739.complete
ATTCAATCCTGGCAGAAAACAAAACCCATCAAATTAAAAGTATTTTAAGA
AAAGTTGTCAATAATTTCGGGTAGCAAATCACTACTTACTTTACAACGAG
TTTTGCTCAAATTCGAAGCTGCATCACCTGCATTTAGGACAGCCAAACAA
ATTTAATCGTCTTAATTAGCAAGCAATGGCACGTGGACACCAGAAGATCC
AGTCGCAGGCGAAGGCCTCCGAGAAGCAGGCCAAACTAAAGAAGCAACAA
GGACACAGTGCCAACGACCAGAAGAAGGCGGCCCAAAAGGCACTTGTCTA
TGTGTGCGCCGTTTGCAAGTCGCAAATGCCCGATCCCAAGACGTATAAAC
AGCACTTCGAGAACAAGCATCCCAAGAACGACATACCCGAGGAGCTGAAG
GAGGTCTGATGATCGTTTCACTTTAAGCTGAACGAGATGGACGAGTTGCC
TACCAGTACGAAACATTTGCAACAATAAATTTGCATCAGCCCTAAGAAGA
AAGCCCACAATCAAGCCGAAGCCAAGAGGATGGATAATAGTCGTAATAAT
AATATACAAATGCCAGTTTTTTCGTATACACACTGCTGAATTTTGGTTTT
GTTTTATACATTGAAATTAACACAGTATGCGATTGTTCGATGTGTGGCTA
AACCAATACAAAGACACCTACCTACCTTAAAAAATGAAAAAAAAAAAAAA
AAAAA

MIP04739.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:28:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG15715-RA 1112 CG15715-RA 238..925 1..688 3440 100 Plus
CG18081-RA 1030 CG18081-RA 179..466 125..412 1230 95.1 Plus
CG18081-RA 1030 CG18081-RA 499..566 425..492 190 85.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15825712..15826080 686..318 1830 99.7 Minus
chr3L 24539361 chr3L 15827087..15827255 169..1 845 100 Minus
chr3L 24539361 chr3L 15826610..15826761 319..168 745 99.3 Minus
chr3L 24539361 chr3L 15824561..15824719 319..161 720 96.9 Minus
chr3L 24539361 chr3L 15824186..15824280 412..318 355 91.6 Minus
chr3L 24539361 chr3L 15824086..15824153 492..425 190 85.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15835880..15836250 688..318 1855 100 Minus
3L 28110227 3L 15837257..15837425 169..1 845 100 Minus
3L 28110227 3L 15836780..15836931 319..168 760 100 Minus
3L 28110227 3L 15834734..15834892 319..161 735 97.5 Minus
3L 28110227 3L 15834359..15834453 412..318 355 91.6 Minus
3L 28110227 3L 15834259..15834326 492..425 190 85.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15828980..15829350 688..318 1855 100 Minus
3L 28103327 3L 15830357..15830525 169..1 845 100 Minus
3L 28103327 3L 15829880..15830031 319..168 760 100 Minus
3L 28103327 3L 15827834..15827992 319..161 735 97.4 Minus
3L 28103327 3L 15827459..15827553 412..318 355 91.5 Minus
3L 28103327 3L 15827359..15827426 492..425 190 85.2 Minus
3L 28103327 3L 15828294..15828338 169..125 165 91.1 Minus
Blast to na_te.dros performed on 2019-03-16 11:37:44 has no hits.

MIP04739.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:38:57 Download gff for MIP04739.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15825712..15826078 320..686 99 <- Minus
chr3L 15826610..15826759 170..319 99 <- Minus
chr3L 15827087..15827255 1..169 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:08:17 Download gff for MIP04739.complete
Subject Subject Range Query Range Percent Splice Strand
CG15715-RA 1..234 176..409 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:42:46 Download gff for MIP04739.complete
Subject Subject Range Query Range Percent Splice Strand
CG15715-RA 1..234 176..409 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:50:37 Download gff for MIP04739.complete
Subject Subject Range Query Range Percent Splice Strand
CG15715-RA 1..234 176..409 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:22:04 Download gff for MIP04739.complete
Subject Subject Range Query Range Percent Splice Strand
CG15715-RA 1..234 176..409 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-03 09:27:33 Download gff for MIP04739.complete
Subject Subject Range Query Range Percent Splice Strand
CG15715-RA 56..741 1..686 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:42:46 Download gff for MIP04739.complete
Subject Subject Range Query Range Percent Splice Strand
CG15715-RA 56..741 1..686 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:50:37 Download gff for MIP04739.complete
Subject Subject Range Query Range Percent Splice Strand
CG15715-RA 58..735 1..678 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:22:04 Download gff for MIP04739.complete
Subject Subject Range Query Range Percent Splice Strand
CG15715-RA 58..735 1..678 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:38:57 Download gff for MIP04739.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15835882..15836248 320..686 100 <- Minus
3L 15836780..15836929 170..319 100 <- Minus
3L 15837257..15837425 1..169 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:38:57 Download gff for MIP04739.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15835882..15836248 320..686 100 <- Minus
3L 15836780..15836929 170..319 100 <- Minus
3L 15837257..15837425 1..169 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:38:57 Download gff for MIP04739.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15835882..15836248 320..686 100 <- Minus
3L 15836780..15836929 170..319 100 <- Minus
3L 15837257..15837425 1..169 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:50:37 Download gff for MIP04739.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15828982..15829348 320..686 100 <- Minus
arm_3L 15829880..15830029 170..319 100 <- Minus
arm_3L 15830357..15830525 1..169 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:17:38 Download gff for MIP04739.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15828982..15829348 320..686 100 <- Minus
3L 15829880..15830029 170..319 100 <- Minus
3L 15830357..15830525 1..169 100   Minus

MIP04739.hyp Sequence

Translation from 175 to 408

> MIP04739.hyp
MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQ
MPDPKTYKQHFENKHPKNDIPEELKEV*

MIP04739.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG15715-PB 77 CG15715-PB 1..77 1..77 404 100 Plus
CG15715-PA 77 CG15715-PA 1..77 1..77 404 100 Plus
CG18081-PC 77 CG18081-PC 1..77 1..77 398 97.4 Plus
CG18081-PB 77 CG18081-PB 1..77 1..77 398 97.4 Plus
CG18081-PA 77 CG18081-PA 1..77 1..77 398 97.4 Plus

MIP04739.pep Sequence

Translation from 175 to 408

> MIP04739.pep
MARGHQKIQSQAKASEKQAKLKKQQGHSANDQKKAAQKALVYVCAVCKSQ
MPDPKTYKQHFENKHPKNDIPEELKEV*

MIP04739.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10372-PA 77 GF10372-PA 1..77 1..77 374 93.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13518-PA 77 GG13518-PA 1..77 1..77 383 97.4 Plus
Dere\GG13517-PA 77 GG13517-PA 1..77 1..77 383 97.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14364-PA 77 GH14364-PA 1..77 1..77 361 88.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG15715-PB 77 CG15715-PB 1..77 1..77 404 100 Plus
CG15715-PA 77 CG15715-PA 1..77 1..77 404 100 Plus
CG18081-PC 77 CG18081-PC 1..77 1..77 398 97.4 Plus
CG18081-PB 77 CG18081-PB 1..77 1..77 398 97.4 Plus
CG18081-PA 77 CG18081-PA 1..77 1..77 398 97.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 10:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20814-PA 77 GI20814-PA 1..77 1..77 370 90.9 Plus
Dmoj\GI11305-PA 77 GI11305-PA 1..77 1..77 364 89.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:43:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24927-PA 77 GL24927-PA 1..77 1..77 365 90.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:43:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14782-PA 77 GA14782-PA 1..77 1..77 365 90.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:43:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24462-PA 77 GM24462-PA 1..77 1..77 389 98.7 Plus
Dsec\GM24461-PA 579 GM24461-PA 522..579 19..77 265 89.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:43:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12534-PA 77 GD12534-PA 1..77 1..77 389 98.7 Plus
Dsim\GD12533-PA 77 GD12533-PA 1..77 1..77 389 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 10:43:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11224-PA 77 GJ11224-PA 1..77 1..77 364 89.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15865-PA 77 GK15865-PA 1..77 1..77 374 93.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22819-PA 77 GE22819-PA 1..77 1..77 389 98.7 Plus
Dyak\GE19809-PA 77 GE19809-PA 1..77 1..77 389 98.7 Plus
Dyak\GE22818-PA 77 GE22818-PA 1..77 1..77 385 97.4 Plus
Dyak\GE19808-PA 77 GE19808-PA 1..77 1..77 385 97.4 Plus