Clone MIP04746 Report

Search the DGRC for MIP04746

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:47
Well:46
Vector:pOT2
Associated Gene/TranscriptCG16824-RA
Protein status:MIP04746.pep: gold
Sequenced Size:425

Clone Sequence Records

MIP04746.complete Sequence

425 bp assembled on 2009-04-03

GenBank Submission: BT081393.1

> MIP04746.complete
AAAAAAGTAAACATTGACAAATACTGATATAGAAATCGACAAAAGTGGGA
AAAGACAATAGCAAGTCAGAATGGCTGGACGCGAGGGCGGTAAGAAGAAG
CCTCTAAAGGCGCCCAAGAAGGACTCGAAGAATCTAGACGAGGAGGACAT
GGCCTTCAAACAGAAGCAGAAGGAGCAGCAGAAGGCTATGGAGGCGGCCA
AGGCAGGTGCCTCCAAGAAGGGACCTCTTCTTGGCGGCGGTATCAAAAAG
TCCGGCAAAAAGTGATCCATTGCCACACCTTCATCTGTATATCTTGGCAT
ATTCAAAACACACCAATGTGGACCAACTTTTATTATCCCTTGAATTGAAG
TCTTCACGTTATTGTACAGCAAATTACTGAAAAAACATATAACTTTTGGT
GTTTGGTAAAAAAAAAAAAAAAAAA

MIP04746.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:28:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG16824-RA 407 CG16824-RA 1..407 1..407 2035 100 Plus
CG13364-RA 541 CG13364-RA 153..369 71..289 575 84.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13291678..13292084 1..407 2035 100 Plus
chrX 22417052 chrX 518889..519083 265..71 570 86.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13293009..13293416 1..408 2040 100 Plus
X 23542271 X 624896..625090 265..71 570 86.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13293009..13293416 1..408 2040 100 Plus
X 23527363 X 632972..633188 289..71 575 84.9 Minus
Blast to na_te.dros performed on 2019-03-16 18:30:30 has no hits.

MIP04746.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:31:22 Download gff for MIP04746.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13291678..13292084 1..407 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:08:19 Download gff for MIP04746.complete
Subject Subject Range Query Range Percent Splice Strand
CG16824-RA 1..195 71..265 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:43:02 Download gff for MIP04746.complete
Subject Subject Range Query Range Percent Splice Strand
CG16824-RA 1..195 71..265 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:13 Download gff for MIP04746.complete
Subject Subject Range Query Range Percent Splice Strand
CG16824-RA 1..195 71..265 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:40:57 Download gff for MIP04746.complete
Subject Subject Range Query Range Percent Splice Strand
CG16824-RA 1..195 71..265 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-03 10:38:18 Download gff for MIP04746.complete
Subject Subject Range Query Range Percent Splice Strand
CG16824-RA 1..195 71..265 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:43:02 Download gff for MIP04746.complete
Subject Subject Range Query Range Percent Splice Strand
CG16824-RA 1..407 1..407 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:13 Download gff for MIP04746.complete
Subject Subject Range Query Range Percent Splice Strand
CG16824-RA 1..407 1..407 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:40:57 Download gff for MIP04746.complete
Subject Subject Range Query Range Percent Splice Strand
CG16824-RA 1..407 1..407 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:31:22 Download gff for MIP04746.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13293009..13293415 1..407 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:31:22 Download gff for MIP04746.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13293009..13293415 1..407 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:31:22 Download gff for MIP04746.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13293009..13293415 1..407 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:13 Download gff for MIP04746.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13293009..13293415 1..407 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:17:57 Download gff for MIP04746.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13293009..13293415 1..407 100   Plus

MIP04746.hyp Sequence

Translation from 70 to 264

> MIP04746.hyp
MAGREGGKKKPLKAPKKDSKNLDEEDMAFKQKQKEQQKAMEAAKAGASKK
GPLLGGGIKKSGKK*

MIP04746.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG16824-PA 64 CG16824-PA 1..64 1..64 324 100 Plus
CG13364-PA 64 CG13364-PA 1..64 1..64 301 90.6 Plus

MIP04746.pep Sequence

Translation from 70 to 264

> MIP04746.pep
MAGREGGKKKPLKAPKKDSKNLDEEDMAFKQKQKEQQKAMEAAKAGASKK
GPLLGGGIKKSGKK*

MIP04746.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:54:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22061-PA 64 GF22061-PA 1..54 1..54 160 83.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:54:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23837-PA 64 GG23837-PA 1..54 1..54 148 92.6 Plus
Dere\GG12752-PA 64 GG12752-PA 1..54 1..54 135 88.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG16824-PA 64 CG16824-PA 1..64 1..64 324 100 Plus
CG13364-PA 64 CG13364-PA 1..64 1..64 301 90.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19032-PA 64 GM19032-PA 1..54 1..54 135 88.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:54:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21753-PA 64 GK21753-PA 1..54 1..54 138 74.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18641-PA 64 GE18641-PA 1..54 1..54 148 94.4 Plus