MIP04746.complete Sequence
425 bp assembled on 2009-04-03
GenBank Submission: BT081393.1
> MIP04746.complete
AAAAAAGTAAACATTGACAAATACTGATATAGAAATCGACAAAAGTGGGA
AAAGACAATAGCAAGTCAGAATGGCTGGACGCGAGGGCGGTAAGAAGAAG
CCTCTAAAGGCGCCCAAGAAGGACTCGAAGAATCTAGACGAGGAGGACAT
GGCCTTCAAACAGAAGCAGAAGGAGCAGCAGAAGGCTATGGAGGCGGCCA
AGGCAGGTGCCTCCAAGAAGGGACCTCTTCTTGGCGGCGGTATCAAAAAG
TCCGGCAAAAAGTGATCCATTGCCACACCTTCATCTGTATATCTTGGCAT
ATTCAAAACACACCAATGTGGACCAACTTTTATTATCCCTTGAATTGAAG
TCTTCACGTTATTGTACAGCAAATTACTGAAAAAACATATAACTTTTGGT
GTTTGGTAAAAAAAAAAAAAAAAAA
MIP04746.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:28:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16824-RA | 407 | CG16824-RA | 1..407 | 1..407 | 2035 | 100 | Plus |
CG13364-RA | 541 | CG13364-RA | 153..369 | 71..289 | 575 | 84.9 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:30:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 13291678..13292084 | 1..407 | 2035 | 100 | Plus |
chrX | 22417052 | chrX | 518889..519083 | 265..71 | 570 | 86.2 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:03:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:30:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 13293009..13293416 | 1..408 | 2040 | 100 | Plus |
X | 23542271 | X | 624896..625090 | 265..71 | 570 | 86.2 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 13293009..13293416 | 1..408 | 2040 | 100 | Plus |
X | 23527363 | X | 632972..633188 | 289..71 | 575 | 84.9 | Minus |
Blast to na_te.dros performed on 2019-03-16 18:30:30 has no hits.
MIP04746.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:31:22 Download gff for
MIP04746.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 13291678..13292084 | 1..407 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:08:19 Download gff for
MIP04746.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16824-RA | 1..195 | 71..265 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:43:02 Download gff for
MIP04746.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16824-RA | 1..195 | 71..265 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:13 Download gff for
MIP04746.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16824-RA | 1..195 | 71..265 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:40:57 Download gff for
MIP04746.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16824-RA | 1..195 | 71..265 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-03 10:38:18 Download gff for
MIP04746.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16824-RA | 1..195 | 71..265 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:43:02 Download gff for
MIP04746.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16824-RA | 1..407 | 1..407 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:13 Download gff for
MIP04746.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16824-RA | 1..407 | 1..407 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:40:57 Download gff for
MIP04746.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16824-RA | 1..407 | 1..407 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:31:22 Download gff for
MIP04746.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 13293009..13293415 | 1..407 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:31:22 Download gff for
MIP04746.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 13293009..13293415 | 1..407 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:31:22 Download gff for
MIP04746.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 13293009..13293415 | 1..407 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:13 Download gff for
MIP04746.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 13293009..13293415 | 1..407 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:17:57 Download gff for
MIP04746.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 13293009..13293415 | 1..407 | 100 | | Plus |
MIP04746.hyp Sequence
Translation from 70 to 264
> MIP04746.hyp
MAGREGGKKKPLKAPKKDSKNLDEEDMAFKQKQKEQQKAMEAAKAGASKK
GPLLGGGIKKSGKK*
MIP04746.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:03:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16824-PA | 64 | CG16824-PA | 1..64 | 1..64 | 324 | 100 | Plus |
CG13364-PA | 64 | CG13364-PA | 1..64 | 1..64 | 301 | 90.6 | Plus |
MIP04746.pep Sequence
Translation from 70 to 264
> MIP04746.pep
MAGREGGKKKPLKAPKKDSKNLDEEDMAFKQKQKEQQKAMEAAKAGASKK
GPLLGGGIKKSGKK*
MIP04746.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:54:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF22061-PA | 64 | GF22061-PA | 1..54 | 1..54 | 160 | 83.3 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:54:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23837-PA | 64 | GG23837-PA | 1..54 | 1..54 | 148 | 92.6 | Plus |
Dere\GG12752-PA | 64 | GG12752-PA | 1..54 | 1..54 | 135 | 88.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16824-PA | 64 | CG16824-PA | 1..64 | 1..64 | 324 | 100 | Plus |
CG13364-PA | 64 | CG13364-PA | 1..64 | 1..64 | 301 | 90.6 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:54:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM19032-PA | 64 | GM19032-PA | 1..54 | 1..54 | 135 | 88.9 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:54:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK21753-PA | 64 | GK21753-PA | 1..54 | 1..54 | 138 | 74.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:54:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18641-PA | 64 | GE18641-PA | 1..54 | 1..54 | 148 | 94.4 | Plus |