Clone MIP04806 Report

Search the DGRC for MIP04806

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:48
Well:6
Vector:pOT2
Associated Gene/TranscriptCG14377-RA
Protein status:MIP04806.pep: gold
Sequenced Size:787

Clone Sequence Records

MIP04806.complete Sequence

787 bp assembled on 2009-02-05

GenBank Submission: BT072931.1

> MIP04806.complete
ACCAACCAACAAACCCAAACAACCAACTCAACATGAAGTTCCTCATCTGT
TTGACCCTGTGCATTGCCGCCGCCCAGGCAGGATTCATCGCATCTCCAGT
GGCCACCTATGCCGCCACCTATTCCGCAGCTGCTCCCTTGGCCTACTCCG
CTCCGGTTACCACCTACTCCGCACCATCATACTCCACCTACGCCGCTGCC
GCCGTTCCCGCCTACACCGCCTACTCCGCCTTAAGTGCTCCTGCTTACAC
TGCTCCTGTGACCACATATGCCGCCGGAACTGCCTATGCTGCTCCCATCA
CCACCTACGCAGCTCCCGCTGTCGTCAGCTCTTTCTTGAAGAAGAAGTAA
ACAGGACTCCTGCAAAAGACATAATGACTCACCCAGGCAATTGATCAAAC
AAAATAAAATTATTATAAAGCAATCTATTATAACTAATCATCTTAATCTA
CTTCATTGTGTAAACCACAAATCCGACTGAGAATCCCCTCTCTTTAAAAG
GCGCAAAATTAGTTGATGGGAGAAATGAAAGGCACTAGCTTAGCATAACT
TCAGGGGGAAAATTTTAACTAAATGTATAATTCACTTCATTAAAAGCAGG
AACATCCAAAGAAAATAGATAATTTGTTATTATTAAAGGCACATTATAAC
CGGACTTACCTTCAACATTACAATAGAAAAACGCTTAAAGTACCATATTT
TATTTCAACTTTATTAAATTGCTACTTTACGATCAGCTCTTTGAAAACTA
AAAAAAAAAAAAAATTAAAAAAAAAAAAAAAAAAAAA

MIP04806.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG14377-RA 751 CG14377-RA 1..751 1..751 3740 99.8 Plus
CG14374-RA 440 CG14374-RA 1..206 8..213 955 97.5 Plus
CG14374-RA 440 CG14374-RA 201..333 226..358 665 100 Plus
CG3419-RB 3385 CG3419-RB 2793..2904 4..115 305 84.8 Plus
CG3419-RB 3385 CG3419-RB 3058..3211 194..350 265 78.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:21:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9223066..9223816 1..751 3575 98.4 Plus
chr3R 27901430 chr3R 9222014..9222367 359..6 1665 98 Minus
chr2R 21145070 chr2R 20301002..20301155 194..350 270 79.6 Plus
chr2R 21145070 chr2R 20300770..20300848 37..115 245 87.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13397835..13398585 1..751 3740 99.9 Plus
3R 32079331 3R 13396801..13397135 358..6 1385 93.5 Minus
2R 25286936 2R 24415078..24415231 194..350 255 79 Plus
2R 25286936 2R 24414846..24414924 37..115 230 86.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13138666..13139416 1..751 3740 99.8 Plus
3R 31820162 3R 13137759..13137966 213..6 965 97.5 Minus
3R 31820162 3R 13137632..13137764 358..226 665 100 Minus
2R 25260384 2R 24416314..24416430 234..350 240 80.3 Plus
2R 25260384 2R 24416045..24416123 37..115 230 86 Plus
Blast to na_te.dros performed on 2019-03-16 09:21:02 has no hits.

MIP04806.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:21:42 Download gff for MIP04806.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9223066..9223808 1..743 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:12 Download gff for MIP04806.complete
Subject Subject Range Query Range Percent Splice Strand
CG14377-RA 1..318 33..350 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:34:04 Download gff for MIP04806.complete
Subject Subject Range Query Range Percent Splice Strand
CG14377-RA 1..318 33..350 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:00:37 Download gff for MIP04806.complete
Subject Subject Range Query Range Percent Splice Strand
CG14377-RA 1..318 33..350 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:08:13 Download gff for MIP04806.complete
Subject Subject Range Query Range Percent Splice Strand
CG14377-RA 1..318 33..350 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-05 16:34:06 Download gff for MIP04806.complete
Subject Subject Range Query Range Percent Splice Strand
CG14377-RA 1..318 33..350 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:34:04 Download gff for MIP04806.complete
Subject Subject Range Query Range Percent Splice Strand
CG14377-RA 1..743 1..743 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:00:37 Download gff for MIP04806.complete
Subject Subject Range Query Range Percent Splice Strand
CG14377-RA 1..743 1..743 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:08:13 Download gff for MIP04806.complete
Subject Subject Range Query Range Percent Splice Strand
CG14377-RA 1..743 1..743 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:21:42 Download gff for MIP04806.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13397835..13398577 1..743 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:21:42 Download gff for MIP04806.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13397835..13398577 1..743 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:21:42 Download gff for MIP04806.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13397835..13398577 1..743 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:00:37 Download gff for MIP04806.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9223557..9224299 1..743 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:07:22 Download gff for MIP04806.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13138666..13139408 1..743 99   Plus

MIP04806.hyp Sequence

Translation from 0 to 393

> MIP04806.hyp
PTNKPKQPTQHEVPHLFDPVHCRRPGRIHRISSGHLCRHLFRSCSLGLLR
SGYHLLRTIILHLRRCRRSRLHRLLRLKCSCLHCSCDHICRWNCLCCSHH
HLRSSRCRQLFLEEEVNRTPAKDIMTHPGN*
Sequence MIP04806.hyp has no blast hits.

MIP04806.pep Sequence

Translation from 2 to 349

> MIP04806.pep
QPTNPNNQLNMKFLICLTLCIAAAQAGFIASPVATYAATYSAAAPLAYSA
PVTTYSAPSYSTYAAAAVPAYTAYSALSAPAYTAPVTTYAAGTAYAAPIT
TYAAPAVVSSFLKKK*

MIP04806.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19665-PA 106 GG19665-PA 1..106 11..115 336 85.8 Plus
Dere\GG17055-PA 98 GG17055-PA 1..98 11..115 306 82.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22658-PA 121 GH22658-PA 1..121 11..115 159 52.8 Plus
Dgri\GH14858-PA 94 GH14858-PA 1..94 11..114 147 56.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG14377-PB 105 CG14377-PB 1..105 11..115 522 100 Plus
CG14377-PA 105 CG14377-PA 1..105 11..115 522 100 Plus
CG14374-PA 99 CG14374-PA 1..99 11..115 466 92.4 Plus
CG45069-PB 129 CG45069-PB 1..129 11..115 371 66.7 Plus
CG45069-PA 129 CG45069-PA 1..129 11..115 371 66.7 Plus
CG13545-PB 98 CG13545-PB 1..98 11..114 190 50.5 Plus
CG32603-PA 345 CG32603-PA 229..329 22..111 157 45.7 Plus
CG11350-PC 456 CG11350-PC 85..163 23..106 153 48.8 Plus
Vml-PB 578 CG34333-PB 315..406 24..109 147 42.3 Plus
Vml-PA 578 CG34333-PA 315..406 24..109 147 42.3 Plus
Vml-PB 578 CG34333-PB 369..481 22..111 146 38.1 Plus
Vml-PA 578 CG34333-PA 369..481 22..111 146 38.1 Plus
Vml-PB 578 CG34333-PB 91..192 22..109 144 42.2 Plus
Vml-PA 578 CG34333-PA 91..192 22..109 144 42.2 Plus
CG13679-PB 119 CG13679-PB 1..95 11..104 138 41.3 Plus
CG13674-PB 137 CG13674-PB 1..137 11..115 135 38.1 Plus
CG13674-PA 137 CG13674-PA 1..137 11..115 135 38.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21168-PA 116 GI21168-PA 1..116 11..115 195 49.6 Plus
Dmoj\GI23690-PA 84 GI23690-PA 1..80 11..105 144 47.9 Plus
Dmoj\GI18911-PA 105 GI18911-PA 1..105 11..115 135 65.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:41:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22735-PA 96 GA22735-PA 1..65 11..92 140 51.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:41:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25940-PA 105 GM25940-PA 1..105 11..115 314 95.2 Plus
Dsec\GM24107-PA 105 GM24107-PA 1..105 11..115 293 95.2 Plus
Dsec\GM15576-PA 319 GM15576-PA 209..319 2..114 139 46 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:41:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18907-PA 105 GD18907-PA 1..105 11..115 458 98.1 Plus
Dsim\GD20501-PA 105 GD20501-PA 1..105 11..115 448 96.2 Plus
Dsim\GD25076-PA 104 GD25076-PA 1..104 11..114 131 46.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21599-PA 114 GJ21599-PA 1..114 11..115 207 59.1 Plus
Dvir\GJ23249-PA 85 GJ23249-PA 1..85 11..114 197 55.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:41:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24444-PA 103 GE24444-PA 1..103 11..115 359 90.5 Plus
Dyak\GE26271-PA 101 GE26271-PA 1..101 11..115 355 88.6 Plus