MIP04806.complete Sequence
787 bp assembled on 2009-02-05
GenBank Submission: BT072931.1
> MIP04806.complete
ACCAACCAACAAACCCAAACAACCAACTCAACATGAAGTTCCTCATCTGT
TTGACCCTGTGCATTGCCGCCGCCCAGGCAGGATTCATCGCATCTCCAGT
GGCCACCTATGCCGCCACCTATTCCGCAGCTGCTCCCTTGGCCTACTCCG
CTCCGGTTACCACCTACTCCGCACCATCATACTCCACCTACGCCGCTGCC
GCCGTTCCCGCCTACACCGCCTACTCCGCCTTAAGTGCTCCTGCTTACAC
TGCTCCTGTGACCACATATGCCGCCGGAACTGCCTATGCTGCTCCCATCA
CCACCTACGCAGCTCCCGCTGTCGTCAGCTCTTTCTTGAAGAAGAAGTAA
ACAGGACTCCTGCAAAAGACATAATGACTCACCCAGGCAATTGATCAAAC
AAAATAAAATTATTATAAAGCAATCTATTATAACTAATCATCTTAATCTA
CTTCATTGTGTAAACCACAAATCCGACTGAGAATCCCCTCTCTTTAAAAG
GCGCAAAATTAGTTGATGGGAGAAATGAAAGGCACTAGCTTAGCATAACT
TCAGGGGGAAAATTTTAACTAAATGTATAATTCACTTCATTAAAAGCAGG
AACATCCAAAGAAAATAGATAATTTGTTATTATTAAAGGCACATTATAAC
CGGACTTACCTTCAACATTACAATAGAAAAACGCTTAAAGTACCATATTT
TATTTCAACTTTATTAAATTGCTACTTTACGATCAGCTCTTTGAAAACTA
AAAAAAAAAAAAAATTAAAAAAAAAAAAAAAAAAAAA
MIP04806.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:22:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14377-RA | 751 | CG14377-RA | 1..751 | 1..751 | 3740 | 99.8 | Plus |
CG14374-RA | 440 | CG14374-RA | 1..206 | 8..213 | 955 | 97.5 | Plus |
CG14374-RA | 440 | CG14374-RA | 201..333 | 226..358 | 665 | 100 | Plus |
CG3419-RB | 3385 | CG3419-RB | 2793..2904 | 4..115 | 305 | 84.8 | Plus |
CG3419-RB | 3385 | CG3419-RB | 3058..3211 | 194..350 | 265 | 78.9 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:21:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 9223066..9223816 | 1..751 | 3575 | 98.4 | Plus |
chr3R | 27901430 | chr3R | 9222014..9222367 | 359..6 | 1665 | 98 | Minus |
chr2R | 21145070 | chr2R | 20301002..20301155 | 194..350 | 270 | 79.6 | Plus |
chr2R | 21145070 | chr2R | 20300770..20300848 | 37..115 | 245 | 87.3 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:21:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 13397835..13398585 | 1..751 | 3740 | 99.9 | Plus |
3R | 32079331 | 3R | 13396801..13397135 | 358..6 | 1385 | 93.5 | Minus |
2R | 25286936 | 2R | 24415078..24415231 | 194..350 | 255 | 79 | Plus |
2R | 25286936 | 2R | 24414846..24414924 | 37..115 | 230 | 86.1 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 13138666..13139416 | 1..751 | 3740 | 99.8 | Plus |
3R | 31820162 | 3R | 13137759..13137966 | 213..6 | 965 | 97.5 | Minus |
3R | 31820162 | 3R | 13137632..13137764 | 358..226 | 665 | 100 | Minus |
2R | 25260384 | 2R | 24416314..24416430 | 234..350 | 240 | 80.3 | Plus |
2R | 25260384 | 2R | 24416045..24416123 | 37..115 | 230 | 86 | Plus |
Blast to na_te.dros performed on 2019-03-16 09:21:02 has no hits.
MIP04806.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:21:42 Download gff for
MIP04806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 9223066..9223808 | 1..743 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:12 Download gff for
MIP04806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14377-RA | 1..318 | 33..350 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:34:04 Download gff for
MIP04806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14377-RA | 1..318 | 33..350 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:00:37 Download gff for
MIP04806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14377-RA | 1..318 | 33..350 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:08:13 Download gff for
MIP04806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14377-RA | 1..318 | 33..350 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-05 16:34:06 Download gff for
MIP04806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14377-RA | 1..318 | 33..350 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:34:04 Download gff for
MIP04806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14377-RA | 1..743 | 1..743 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:00:37 Download gff for
MIP04806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14377-RA | 1..743 | 1..743 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:08:13 Download gff for
MIP04806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14377-RA | 1..743 | 1..743 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:21:42 Download gff for
MIP04806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13397835..13398577 | 1..743 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:21:42 Download gff for
MIP04806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13397835..13398577 | 1..743 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:21:42 Download gff for
MIP04806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13397835..13398577 | 1..743 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:00:37 Download gff for
MIP04806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 9223557..9224299 | 1..743 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:07:22 Download gff for
MIP04806.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13138666..13139408 | 1..743 | 99 | | Plus |
MIP04806.hyp Sequence
Translation from 0 to 393
> MIP04806.hyp
PTNKPKQPTQHEVPHLFDPVHCRRPGRIHRISSGHLCRHLFRSCSLGLLR
SGYHLLRTIILHLRRCRRSRLHRLLRLKCSCLHCSCDHICRWNCLCCSHH
HLRSSRCRQLFLEEEVNRTPAKDIMTHPGN*
Sequence MIP04806.hyp has no blast hits.
MIP04806.pep Sequence
Translation from 2 to 349
> MIP04806.pep
QPTNPNNQLNMKFLICLTLCIAAAQAGFIASPVATYAATYSAAAPLAYSA
PVTTYSAPSYSTYAAAAVPAYTAYSALSAPAYTAPVTTYAAGTAYAAPIT
TYAAPAVVSSFLKKK*
MIP04806.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:41:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG19665-PA | 106 | GG19665-PA | 1..106 | 11..115 | 336 | 85.8 | Plus |
Dere\GG17055-PA | 98 | GG17055-PA | 1..98 | 11..115 | 306 | 82.9 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:41:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH22658-PA | 121 | GH22658-PA | 1..121 | 11..115 | 159 | 52.8 | Plus |
Dgri\GH14858-PA | 94 | GH14858-PA | 1..94 | 11..114 | 147 | 56.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14377-PB | 105 | CG14377-PB | 1..105 | 11..115 | 522 | 100 | Plus |
CG14377-PA | 105 | CG14377-PA | 1..105 | 11..115 | 522 | 100 | Plus |
CG14374-PA | 99 | CG14374-PA | 1..99 | 11..115 | 466 | 92.4 | Plus |
CG45069-PB | 129 | CG45069-PB | 1..129 | 11..115 | 371 | 66.7 | Plus |
CG45069-PA | 129 | CG45069-PA | 1..129 | 11..115 | 371 | 66.7 | Plus |
CG13545-PB | 98 | CG13545-PB | 1..98 | 11..114 | 190 | 50.5 | Plus |
CG32603-PA | 345 | CG32603-PA | 229..329 | 22..111 | 157 | 45.7 | Plus |
CG11350-PC | 456 | CG11350-PC | 85..163 | 23..106 | 153 | 48.8 | Plus |
Vml-PB | 578 | CG34333-PB | 315..406 | 24..109 | 147 | 42.3 | Plus |
Vml-PA | 578 | CG34333-PA | 315..406 | 24..109 | 147 | 42.3 | Plus |
Vml-PB | 578 | CG34333-PB | 369..481 | 22..111 | 146 | 38.1 | Plus |
Vml-PA | 578 | CG34333-PA | 369..481 | 22..111 | 146 | 38.1 | Plus |
Vml-PB | 578 | CG34333-PB | 91..192 | 22..109 | 144 | 42.2 | Plus |
Vml-PA | 578 | CG34333-PA | 91..192 | 22..109 | 144 | 42.2 | Plus |
CG13679-PB | 119 | CG13679-PB | 1..95 | 11..104 | 138 | 41.3 | Plus |
CG13674-PB | 137 | CG13674-PB | 1..137 | 11..115 | 135 | 38.1 | Plus |
CG13674-PA | 137 | CG13674-PA | 1..137 | 11..115 | 135 | 38.1 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:41:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI21168-PA | 116 | GI21168-PA | 1..116 | 11..115 | 195 | 49.6 | Plus |
Dmoj\GI23690-PA | 84 | GI23690-PA | 1..80 | 11..105 | 144 | 47.9 | Plus |
Dmoj\GI18911-PA | 105 | GI18911-PA | 1..105 | 11..115 | 135 | 65.5 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:41:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA22735-PA | 96 | GA22735-PA | 1..65 | 11..92 | 140 | 51.8 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:41:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25940-PA | 105 | GM25940-PA | 1..105 | 11..115 | 314 | 95.2 | Plus |
Dsec\GM24107-PA | 105 | GM24107-PA | 1..105 | 11..115 | 293 | 95.2 | Plus |
Dsec\GM15576-PA | 319 | GM15576-PA | 209..319 | 2..114 | 139 | 46 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:41:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD18907-PA | 105 | GD18907-PA | 1..105 | 11..115 | 458 | 98.1 | Plus |
Dsim\GD20501-PA | 105 | GD20501-PA | 1..105 | 11..115 | 448 | 96.2 | Plus |
Dsim\GD25076-PA | 104 | GD25076-PA | 1..104 | 11..114 | 131 | 46.2 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:41:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ21599-PA | 114 | GJ21599-PA | 1..114 | 11..115 | 207 | 59.1 | Plus |
Dvir\GJ23249-PA | 85 | GJ23249-PA | 1..85 | 11..114 | 197 | 55.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:41:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE24444-PA | 103 | GE24444-PA | 1..103 | 11..115 | 359 | 90.5 | Plus |
Dyak\GE26271-PA | 101 | GE26271-PA | 1..101 | 11..115 | 355 | 88.6 | Plus |