Clone MIP04942 Report

Search the DGRC for MIP04942

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:49
Well:42
Vector:pOT2
Associated Gene/TranscriptCG15891-RA
Protein status:MIP04942.pep: gold
Sequenced Size:580

Clone Sequence Records

MIP04942.complete Sequence

580 bp assembled on 2009-04-03

GenBank Submission: BT081398.1

> MIP04942.complete
AATAGAACAAAATAGTGCAATGTTTTCGATATTTGGCAAACGCAAGCCCG
CGGAAACGCCCACGGATGACCAGCCCATCCAGGGACCGGCGGAGGCAACC
CGTCCAGGCACCAGTGTCGATGATTTCGTGTTCATAGAGCGCAAACCAGT
ACCGGATGCTCCTCATCCGGGTGTTCCAGCCGGCTCCATGTATCCACCTA
TGCCGCCAGCGGGCTATCTGCCCTATCCGCCGATGCCAGGACCGCGCAGC
GATCAAGTGAAGCAGCCCGGAGCCCAAGGACCCGTCAATTACTTGCAGGA
CATTCCATTCGAGCTGGCACCCGGATTGGCCAACAAGGATCGCTACACCA
GCACCCAAATGCAGGTGGACAGCATATTGGCGCTACTAACGCGCCAATTG
TCCGTGGACGAGCTGGCCGAGGAGTACACCTTCGCCCTGGAGCGATCCGT
GCAGAACGAGTGTTACTAGCTTTAGATCCATAGATCCACTGGTTAATATT
CATACATTACATTACATTACATATAATAAAACGTTGCTTATTTAATTGTA
AACCACAAAAAAAAAAAAAAAAAAAAAAAA

MIP04942.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG15892-RB 1947 CG15892-RB 44..600 1..557 2785 100 Plus
CG15891-RA 1947 CG15891-RA 44..600 1..557 2785 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:07:18
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 6186697..6187252 556..1 2780 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:07:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6294516..6295072 557..1 2785 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 6302614..6303170 557..1 2785 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:07:17 has no hits.

MIP04942.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:08:19 Download gff for MIP04942.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 6186697..6187252 1..556 96   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:08:18 Download gff for MIP04942.complete
Subject Subject Range Query Range Percent Splice Strand
CG15891-RA 1..450 20..469 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:42:45 Download gff for MIP04942.complete
Subject Subject Range Query Range Percent Splice Strand
CG15891-RA 1..450 20..469 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:03:16 Download gff for MIP04942.complete
Subject Subject Range Query Range Percent Splice Strand
CG15891-RA 1..450 20..469 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:27:33 Download gff for MIP04942.complete
Subject Subject Range Query Range Percent Splice Strand
CG15891-RA 1..450 20..469 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-03 09:27:33 Download gff for MIP04942.complete
Subject Subject Range Query Range Percent Splice Strand
CG15891-RA 44..599 1..556 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:42:45 Download gff for MIP04942.complete
Subject Subject Range Query Range Percent Splice Strand
CG15892-RB 44..599 1..556 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:03:16 Download gff for MIP04942.complete
Subject Subject Range Query Range Percent Splice Strand
CG15891-RA 44..599 1..556 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:27:33 Download gff for MIP04942.complete
Subject Subject Range Query Range Percent Splice Strand
CG15891-RA 44..599 1..556 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:19 Download gff for MIP04942.complete
Subject Subject Range Query Range Percent Splice Strand
X 6294517..6295072 1..556 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:19 Download gff for MIP04942.complete
Subject Subject Range Query Range Percent Splice Strand
X 6294517..6295072 1..556 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:19 Download gff for MIP04942.complete
Subject Subject Range Query Range Percent Splice Strand
X 6294517..6295072 1..556 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:03:16 Download gff for MIP04942.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6188550..6189105 1..556 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:17:37 Download gff for MIP04942.complete
Subject Subject Range Query Range Percent Splice Strand
X 6302615..6303170 1..556 100   Minus

MIP04942.hyp Sequence

Translation from 0 to 468

> MIP04942.hyp
IEQNSAMFSIFGKRKPAETPTDDQPIQGPAEATRPGTSVDDFVFIERKPV
PDAPHPGVPAGSMYPPMPPAGYLPYPPMPGPRSDQVKQPGAQGPVNYLQD
IPFELAPGLANKDRYTSTQMQVDSILALLTRQLSVDELAEEYTFALERSV
QNECY*

MIP04942.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG15891-PD 149 CG15891-PD 1..149 7..155 797 100 Plus
CG15891-PA 149 CG15891-PA 1..149 7..155 797 100 Plus

MIP04942.pep Sequence

Translation from 1 to 468

> MIP04942.pep
IEQNSAMFSIFGKRKPAETPTDDQPIQGPAEATRPGTSVDDFVFIERKPV
PDAPHPGVPAGSMYPPMPPAGYLPYPPMPGPRSDQVKQPGAQGPVNYLQD
IPFELAPGLANKDRYTSTQMQVDSILALLTRQLSVDELAEEYTFALERSV
QNECY*

MIP04942.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:43:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21018-PA 150 GF21018-PA 1..150 7..154 516 76.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:43:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17679-PA 148 GG17679-PA 1..148 7..155 641 87.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:43:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24155-PA 147 GH24155-PA 1..147 7..155 421 59.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG15891-PD 149 CG15891-PD 1..149 7..155 797 100 Plus
CG15891-PA 149 CG15891-PA 1..149 7..155 797 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 10:43:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15526-PA 146 GI15526-PA 1..146 7..155 389 59.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:43:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14181-PA 125 GL14181-PA 1..124 7..154 309 51.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:43:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17197-PA 125 GA17197-PA 1..124 7..154 305 50.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:43:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12579-PA 149 GM12579-PA 1..149 7..155 749 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:43:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16197-PA 136 GD16197-PA 1..136 7..155 606 82.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 10:43:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14729-PA 148 GJ14729-PA 1..148 7..155 421 60.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19788-PA 158 GK19788-PA 1..158 7..155 440 62.7 Plus