Clone MIP05209 Report

Search the DGRC for MIP05209

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:52
Well:9
Vector:pOT2
Associated Gene/TranscriptCG43328-RA
Protein status:MIP05209.pep: gold
Sequenced Size:1467

Clone Sequence Records

MIP05209.complete Sequence

1467 bp assembled on 2009-02-05

GenBank Submission: BT058087.1

> MIP05209.complete
ATTTTCATCCACATCAAGGGTCAAGCTAAAATTATAACCAAAGTGAAAAG
ATTTAGTTTCAAAATTAAATTCTCTATTGGATTATATATACGGAATAGGC
ATGTCTGTGAGTCAACTTAAGCCGGAAGAGCAGGTGGTCATTGCAGCCTC
TGAGAATCTATCAATGGGTCCTTTCCCACTTGGAGAAAGCCAGTTCAGTT
TCGTGGCTGCAACAACTGCAGTGTGGCTCTCCAGCGGGGATTCTACTTCT
CCCTTCGGATGCCCGACTGGGCTAAGGACTTTAAGCACCAGACCCAGAAG
ATACTATCCCATGGTTTTGACTGCCCAAGGAGAAGTTTCAAAAGCAGCAA
CGACTCGGAGATATCGAAATTCTATGGAGATTATCGTTCTGAACGTTATG
GCGAAATCTTTTCGGAGAGCAGTAATGCAAGATTCTTTGAAAACATTCCC
GGAGAAATGCAAGTTTCCAATCAAACGAAATCAAAGCGAGCACTGCGATC
ACCCAAGATTAAGGACGACTTAACGTGTGGCAAAAAGGTGCCATCCTAAA
TACCCTGGCATTGGCTGTCGAAAATTCGAGGTCACACAGGAAACATCATA
AGGAGTTCGGGATTTCGAAGCTTGGTAAAATGGTTGTGGGCCTGATTTTG
CGAGCGGGCGTTGTCTATGCTGTGGTAATGGTCACCAAGAACTACGGCGT
GTGGGAATCTCCAAACAAGACGCAAGATGTGTACGATGAAACCGTGGAGC
GCATCGAACCCTACGCCGATCAGGCGCGACGTAAACTAAATATATGCCCG
CCTAGGCCGCCACCGGAGGGAGAATGGTCCTTCTTTGGCATCTACTACTA
CAACAAATTAGTTAAATCGGTTTTCGACTTACTAAGCGTCTTTCCCGCTG
GACTAGCTGCGTTTTTGGAGAAAGTACCAAGCTATGTCAACGCTTTTAAC
GAAACCATTCAAAAGTACATTAAGGAGAGCCAGTCTAAGAAGAAAGAAAT
AACGATATCCAAGGGACAGCTGGACGAGACTCCTCTGGTCAGACCTCCCG
GACTGGTGCCACCGCATTGCAAAGACAAGAACTGTCCGAAGGCTCCTCTG
ATTCCACCAGGATGCGACCGGAACAGGGATAGCTTTATCTACGAGCCGCG
TTTACCCAAGAAGCCACCGTGCGAGTGCGCCAAGTGCAAGCAACGTCAGG
CGGAGAATTGGAAGGACAACAAACGCAAGTGCCCCAGAATACCGAGCAGT
GAAGCCAAGTGTAGATGTGGAGAGGGTCCCCAGTCGGAAGCCCGCTCGGA
GCCCATCAAATCGTGCAAACAGTGCCGAAAGACGCCTCGAGAAACCGCTA
CCTAGAAATCCCCTGAACCAAATCTCCTCAGACCATTGAACAAATTTATT
GTACCATCATCTAGACAATATAAATTTGGTTGCTTTCTTGAAAAAAAAAA
AAAAAAAAAAAAAAAAA

MIP05209.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG30459-RA 1193 CG30459-RA 428..1193 590..1355 3830 100 Plus
CG30459-RA 1193 CG30459-RA 1..428 99..525 2100 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:16:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12919689..12921129 1440..1 7050 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:04:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:16:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17032484..17033927 1443..1 7170 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17033683..17035126 1443..1 7180 99.9 Minus
Blast to na_te.dros performed on 2019-03-15 23:16:16 has no hits.

MIP05209.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:17:13 Download gff for MIP05209.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12919689..12921129 1..1440 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:16 Download gff for MIP05209.complete
Subject Subject Range Query Range Percent Splice Strand
CG30459-RA 1..425 101..524 99 == Plus
CG30459-RA 426..1191 590..1355 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:34:07 Download gff for MIP05209.complete
Subject Subject Range Query Range Percent Splice Strand
CG30459-RA 426..1191 590..1355 100   Plus
CG30459-RA 1..425 101..524 99 == Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:35:49 Download gff for MIP05209.complete
Subject Subject Range Query Range Percent Splice Strand
CG43328-RA 1..726 630..1355 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:26:54 Download gff for MIP05209.complete
Subject Subject Range Query Range Percent Splice Strand
CG43328-RA 1..726 630..1355 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-05 17:53:09 Download gff for MIP05209.complete
Subject Subject Range Query Range Percent Splice Strand
CG30459-RA 1..427 99..524 99 == Plus
CG30459-RA 428..1193 590..1355 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:34:07 Download gff for MIP05209.complete
Subject Subject Range Query Range Percent Splice Strand
CG30459-RA 1..427 99..524 99 == Plus
CG30459-RA 428..1193 590..1355 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:35:49 Download gff for MIP05209.complete
Subject Subject Range Query Range Percent Splice Strand
CG43327-RA 1..1441 1..1440 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:26:54 Download gff for MIP05209.complete
Subject Subject Range Query Range Percent Splice Strand
CG43327-RA 86..1526 1..1440 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:17:13 Download gff for MIP05209.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17032487..17033927 1..1440 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:17:13 Download gff for MIP05209.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17032487..17033927 1..1440 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:17:13 Download gff for MIP05209.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17032487..17033927 1..1440 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:35:49 Download gff for MIP05209.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12919992..12921432 1..1440 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:07:27 Download gff for MIP05209.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17033686..17035126 1..1440 99   Minus

MIP05209.pep Sequence

Translation from 629 to 1354

> MIP05209.pep
MVVGLILRAGVVYAVVMVTKNYGVWESPNKTQDVYDETVERIEPYADQAR
RKLNICPPRPPPEGEWSFFGIYYYNKLVKSVFDLLSVFPAGLAAFLEKVP
SYVNAFNETIQKYIKESQSKKKEITISKGQLDETPLVRPPGLVPPHCKDK
NCPKAPLIPPGCDRNRDSFIYEPRLPKKPPCECAKCKQRQAENWKDNKRK
CPRIPSSEAKCRCGEGPQSEARSEPIKSCKQCRKTPRETAT*

MIP05209.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13430-PA 367 GF13430-PA 146..365 1..220 622 60.5 Plus
Dana\GF24204-PA 121 GF24204-PA 1..109 1..109 165 32.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22223-PA 396 GG22223-PA 156..396 1..241 1193 91.7 Plus
Dere\GG13616-PA 122 GG13616-PA 1..109 1..109 155 27.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15187-PA 124 GH15187-PA 1..109 1..109 169 33 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG43328-PB 241 CG43328-PB 1..241 1..241 1315 100 Plus
CG43328-PA 241 CG43328-PA 1..241 1..241 1315 100 Plus
QIL1-PA 122 CG7603-PA 1..109 1..109 156 28.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12127-PA 125 GI12127-PA 1..109 1..109 164 30.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11608-PA 242 GL11608-PA 1..233 1..232 416 41.8 Plus
Dper\GL15582-PA 124 GL15582-PA 1..89 1..89 152 31.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24789-PA 258 GA24789-PA 1..249 1..232 481 44.5 Plus
Dpse\GA20474-PA 124 GA20474-PA 1..89 1..89 148 30.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:43:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20011-PA 396 GM20011-PA 156..396 1..241 1270 98.3 Plus
Dsec\GM25700-PA 122 GM25700-PA 1..109 1..109 156 27.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:43:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25500-PA 396 GD25500-PA 156..396 1..241 1264 97.5 Plus
Dsim\GD14707-PA 122 GD14707-PA 1..109 1..109 149 26.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13399-PA 126 GJ13399-PA 1..106 1..106 174 35.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17742-PA 128 GK17742-PA 1..109 1..109 171 33 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:43:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14221-PA 389 GE14221-PA 156..389 1..241 1147 88.8 Plus
Dyak\GE19912-PA 122 GE19912-PA 1..109 1..109 152 27.5 Plus

MIP05209.hyp Sequence

Translation from 629 to 1354

> MIP05209.hyp
MVVGLILRAGVVYAVVMVTKNYGVWESPNKTQDVYDETVERIEPYADQAR
RKLNICPPRPPPEGEWSFFGIYYYNKLVKSVFDLLSVFPAGLAAFLEKVP
SYVNAFNETIQKYIKESQSKKKEITISKGQLDETPLVRPPGLVPPHCKDK
NCPKAPLIPPGCDRNRDSFIYEPRLPKKPPCECAKCKQRQAENWKDNKRK
CPRIPSSEAKCRCGEGPQSEARSEPIKSCKQCRKTPRETAT*

MIP05209.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG43328-PB 241 CG43328-PB 1..241 1..241 1315 100 Plus
CG43328-PA 241 CG43328-PA 1..241 1..241 1315 100 Plus
CG7603-PA 122 CG7603-PA 1..109 1..109 156 28.4 Plus